Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA23485_WB7.jpg WB (Western Blot) (WB Suggested Anti-PUF60 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysatePUF60 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit PUF60 Polyclonal Antibody | anti-PUF60 antibody

PUF60 antibody - C-terminal region

Gene Names
PUF60; FIR; VRJS; RoBPI; SIAHBP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PUF60, Antibody; PUF60 antibody - C-terminal region; anti-PUF60 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
Sequence Length
542
Applicable Applications for anti-PUF60 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PUF60
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PUF60 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysatePUF60 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA23485_WB7.jpg WB (Western Blot) (WB Suggested Anti-PUF60 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysatePUF60 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: PUF60Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23485_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: PUF60Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PUF60Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23485_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: PUF60Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Sample Type: Human 293TWB Suggested Anti-PUF60 Antibody Titration: 0.5ug/ml Positive Control: Human 293T Cell Lysate)

product-image-AAA23485_WB4.jpg WB (Western Blot) (Sample Type: Human 293TWB Suggested Anti-PUF60 Antibody Titration: 0.5ug/ml Positive Control: Human 293T Cell Lysate)

IHC (Immunohistochemistry)

product-image-AAA23485_IHC3.jpg IHC (Immunohistochemistry)

IHC (Immunohistochemistry)

(Rabbit Anti-PUF60 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23485_IHC2.jpg IHC (Immunohistochemistry) (Rabbit Anti-PUF60 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-PUF60 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA23485_IHC.jpg IHC (Immunohistochemistry) (Rabbit Anti-PUF60 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-PUF60 antibody
This is a rabbit polyclonal antibody against PUF60. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.The protein encoded by this gene is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene.The protein encoded by this gene is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
poly(U)-binding-splicing factor PUF60 isoform b
NCBI Official Synonym Full Names
poly(U) binding splicing factor 60
NCBI Official Symbol
PUF60
NCBI Official Synonym Symbols
FIR; VRJS; RoBPI; SIAHBP1
NCBI Protein Information
poly(U)-binding-splicing factor PUF60
UniProt Protein Name
Poly(U)-binding-splicing factor PUF60
UniProt Gene Name
PUF60
UniProt Synonym Gene Names
FIR; ROBPI; SIAHBP1; FBP-interacting repressor; RoBP1; Siah-BP1
UniProt Entry Name
PUF60_HUMAN

Similar Products

Product Notes

The PUF60 puf60 (Catalog #AAA23485) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PUF60 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PUF60 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PUF60 puf60 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIIVKIFVEF SIASETHKAI QALNGRWFAG RKVVAEVYDQ ERFDNSDLSA. It is sometimes possible for the material contained within the vial of "PUF60, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.