Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201728_WB8.jpg WB (Western Blot) (WB Suggested Anti-RAB14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that RAB14 is expressed in HepG2)

Rabbit RAB14 Polyclonal Antibody | anti-RAB14 antibody

RAB14 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
RAB14; FBP; RAB-14
Reactivity
Cow, Dog, Goat, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RAB14, Antibody; RAB14 antibody - C-terminal region; anti-RAB14 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG
Sequence Length
215
Applicable Applications for anti-RAB14 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RAB14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RAB14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that RAB14 is expressed in HepG2)

product-image-AAA201728_WB8.jpg WB (Western Blot) (WB Suggested Anti-RAB14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that RAB14 is expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: RAB14Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.0ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%There is BioGPS gene expression data showing that RAB14 is expressed in HepG2)

product-image-AAA201728_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: RAB14Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.0ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%There is BioGPS gene expression data showing that RAB14 is expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: RAB14Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201728_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: RAB14Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RAB14Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA201728_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: RAB14Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Lanes :Murin JAWS-II cell line Primary Antibody Dilution :1:100 Secondary Antibody :Anti-rabbit-FITC Secondary Antibody Dilution :1:1000 Gene Name :Blue: Nucleus Green: Rab14 Submitted by :RAB14)

product-image-AAA201728_IHC15.jpg IHC (Immunohistochemistry) (Lanes :Murin JAWS-II cell line Primary Antibody Dilution :1:100 Secondary Antibody :Anti-rabbit-FITC Secondary Antibody Dilution :1:1000 Gene Name :Blue: Nucleus Green: Rab14 Submitted by :RAB14)
Related Product Information for anti-RAB14 antibody
This is a rabbit polyclonal antibody against RAB14. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Localized to biosynthetic and endosomal compartments, Rab14 is involved in the biosynthetic/recycling pathway between the Golgi and endosomal compartments.
Product Categories/Family for anti-RAB14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ras-related protein Rab-14
NCBI Official Synonym Full Names
RAB14, member RAS oncogene family
NCBI Official Symbol
RAB14
NCBI Official Synonym Symbols
FBP; RAB-14
NCBI Protein Information
ras-related protein Rab-14
UniProt Protein Name
Ras-related protein Rab-14
UniProt Gene Name
RAB14
UniProt Entry Name
RAB14_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RAB14 rab14 (Catalog #AAA201728) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB14 antibody - C-terminal region reacts with Cow, Dog, Goat, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB14 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the RAB14 rab14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLEAAKKIYQ NIQDGSLDLN AAESGVQHKP SAPQGGRLTS EPQPQREGCG. It is sometimes possible for the material contained within the vial of "RAB14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.