Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200706_WB13.jpg WB (Western Blot) (WB Suggested Anti-RAB22A Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateRAB22A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Rabbit RAB22A Polyclonal Antibody | anti-RAB22A antibody

RAB22A antibody - middle region

Average rating 0.0
No ratings yet
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RAB22A, Antibody; RAB22A antibody - middle region; anti-RAB22A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS
Sequence Length
194
Applicable Applications for anti-RAB22A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RAB22A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RAB22A Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateRAB22A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

product-image-AAA200706_WB13.jpg WB (Western Blot) (WB Suggested Anti-RAB22A Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateRAB22A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

IHC (Immunohistochemistry)

(Lanes :Murin JAWS-II cells Primary Antibody Dilution :1:1000 Secondary Antibody :Anti-rabbit-FITC Secondary Antibody Dilution :1:1500 Gene Name :Blue: Nucleus Green: Rab22a Submitted by :RAB22A)

product-image-AAA200706_IHC15.jpg IHC (Immunohistochemistry) (Lanes :Murin JAWS-II cells Primary Antibody Dilution :1:1000 Secondary Antibody :Anti-rabbit-FITC Secondary Antibody Dilution :1:1500 Gene Name :Blue: Nucleus Green: Rab22a Submitted by :RAB22A)
Related Product Information for anti-RAB22A antibody
This is a rabbit polyclonal antibody against RAB22A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom
Product Categories/Family for anti-RAB22A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
ras-related protein Rab-22A
NCBI Official Synonym Full Names
RAB22A, member RAS oncogene family
NCBI Official Symbol
RAB22A
NCBI Protein Information
ras-related protein Rab-22A
UniProt Protein Name
Ras-related protein Rab-22A
UniProt Gene Name
Rab22a
UniProt Synonym Gene Names
Rab22; Rab-22
UniProt Entry Name
RB22A_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RAB22A rab22a (Catalog #AAA200706) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB22A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB22A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the RAB22A rab22a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IFVETSAKNA ININELFIEI SRRIPSTDAN LPSGGKGFKL RRQPSEPKRS. It is sometimes possible for the material contained within the vial of "RAB22A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.