Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281594_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Mouse testis using RABGAP1 Rabbit pAb at dilution of 1:100 (40x lens).)

Rabbit anti-Human, Mouse RABGAP1 Polyclonal Antibody | anti-RABGAP1 antibody

RABGAP1 Rabbit pAb

Gene Names
RABGAP1; GAPCENA; TBC1D11; RP11-123N4.2
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
RABGAP1, Antibody; RABGAP1 Rabbit pAb; RABGAP1; GAPCENA; TBC1D11; anti-RABGAP1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
QQEDPIERFERENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEEEKRRLEEESAQLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIEKIRQKVDDCERCREFFNKEGRVKGISSTKEVLDEDTDEEKETLKNQLREMELELAQTKLQLVEAECKIQDLEHHLGLALNEVQAAKKTWFNRTLSSIKTATGVQGKETC
Applicable Applications for anti-RABGAP1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 830-1069 of human RABGAP1 (NP_036329.3).
Cellular Location
Cytoplasm, centrosome, cytoskeleton, cytosol, microtubule organizing center
Positive Samples
U-87MG, HeLa, Mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded Mouse testis using RABGAP1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281594_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Mouse testis using RABGAP1 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Human colon carcinoma using RABGAP1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281594_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Human colon carcinoma using RABGAP1 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using RABGAP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281594_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using RABGAP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Product Categories/Family for anti-RABGAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
121,737 Da
NCBI Official Full Name
RABGAP1 protein
NCBI Official Synonym Full Names
RAB GTPase activating protein 1
NCBI Official Symbol
RABGAP1
NCBI Official Synonym Symbols
GAPCENA; TBC1D11; RP11-123N4.2
NCBI Protein Information
rab GTPase-activating protein 1; TBC1 domain family, member 11; GAP and centrosome-associated protein; rab6 GTPase-activating protein GAPCenA; Rab6 GTPase activating protein, GAPCenA; rab6 GTPase activating protein (GAP and centrosome-associated)
UniProt Protein Name
Rab GTPase-activating protein 1
UniProt Gene Name
RABGAP1
UniProt Entry Name
RBGP1_HUMAN

Similar Products

Product Notes

The RABGAP1 rabgap1 (Catalog #AAA281594) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RABGAP1 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RABGAP1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RABGAP1 rabgap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QQEDPIERFE RENRRLQEAN MRLEQENDDL AHELVTSKIA LRKDLDNAEE KADALNKELL MTKQKLIDAE EEKRRLEEES AQLKEMCRRE LDKAESEIKK NSSIIGDYKQ ICSQLSERLE KQQTANKVEI EKIRQKVDDC ERCREFFNKE GRVKGISSTK EVLDEDTDEE KETLKNQLRE MELELAQTKL QLVEAECKIQ DLEHHLGLAL NEVQAAKKTW FNRTLSSIKT ATGVQGKETC. It is sometimes possible for the material contained within the vial of "RABGAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.