Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197716_WB11.jpg WB (Western Blot) (WB Suggested Anti-RALY Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateRALY is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit RALY Polyclonal Antibody | anti-RALY antibody

RALY antibody - N-terminal region

Gene Names
RALY; P542; HNRPCL2
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RALY, Antibody; RALY antibody - N-terminal region; anti-RALY antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ
Sequence Length
306
Applicable Applications for anti-RALY antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RALY
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RALY Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateRALY is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA197716_WB11.jpg WB (Western Blot) (WB Suggested Anti-RALY Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateRALY is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: RALYSample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

product-image-AAA197716_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: RALYSample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Human Brain)

product-image-AAA197716_IHC15.jpg IHC (Immunohistochemistry) (Human Brain)
Related Product Information for anti-RALY antibody
This is a rabbit polyclonal antibody against RALY. It was validated on Western Blot and immunohistochemistry

Target Description: In infectious mononucleosis, anti-EBNA-1 antibodies are produced which cross-react with multiple normal human proteins. The cross-reactivity is due to anti-gly/ala antibodies that cross-react with host proteins containing configurations like those in the EBNA-1 repeat. One such antigen is RALY which is a member of the heterogeneous nuclear ribonucleoprotein gene family.
Product Categories/Family for anti-RALY antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
RNA-binding protein Raly isoform 2
NCBI Official Synonym Full Names
RALY heterogeneous nuclear ribonucleoprotein
NCBI Official Symbol
RALY
NCBI Official Synonym Symbols
P542; HNRPCL2
NCBI Protein Information
RNA-binding protein Raly
UniProt Protein Name
RNA-binding protein Raly
UniProt Gene Name
RALY
UniProt Synonym Gene Names
HNRPCL2; P542; hnRNP core protein C-like 2
UniProt Entry Name
RALY_HUMAN

Similar Products

Product Notes

The RALY raly (Catalog #AAA197716) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RALY antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RALY can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the RALY raly for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NKNDPKSINS RVFIGNLNTA LVKKSDVETI FSKYGRVAGC SVHKGYAFVQ. It is sometimes possible for the material contained within the vial of "RALY, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.