Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281025_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of MCF-7 cells using RANGAP1 antibody.)

Rabbit anti-Human, Duck RANGAP1 Polyclonal Antibody | anti-RANGAP1 antibody

RANGAP1 Polyclonal Antibody

Gene Names
RANGAP1; SD; Fug1; RANGAP
Reactivity
Human, Duck
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
RANGAP1, Antibody; RANGAP1 Polyclonal Antibody; Fug1; RANGAP; SD; anti-RANGAP1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Duck
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
PQQRGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Sequence Length
587
Applicable Applications for anti-RANGAP1 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human RANGAP1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Chromosome, Cytoplasm, Cytoplasmic side, Nucleus membrane, Peripheral membrane protein, centromere, cytoskeleton, kinetochore, spindle pole
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of MCF-7 cells using RANGAP1 antibody.)

product-image-AAA281025_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of MCF-7 cells using RANGAP1 antibody.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using RANGAP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA281025_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using RANGAP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-RANGAP1 antibody
This gene encodes a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. The encoded protein interacts with Ras-related nuclear protein 1 (RAN) and regulates guanosine triphosphate (GTP)-binding and exchange. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-RANGAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 63kDa
Observed: 90kDa
NCBI Official Full Name
ran GTPase-activating protein 1
NCBI Official Synonym Full Names
Ran GTPase activating protein 1
NCBI Official Symbol
RANGAP1
NCBI Official Synonym Symbols
SD; Fug1; RANGAP
NCBI Protein Information
ran GTPase-activating protein 1
UniProt Protein Name
Ran GTPase-activating protein 1
UniProt Gene Name
RANGAP1
UniProt Synonym Gene Names
KIAA1835; SD; RanGAP1

Similar Products

Product Notes

The RANGAP1 rangap1 (Catalog #AAA281025) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RANGAP1 Polyclonal Antibody reacts with Human, Duck and may cross-react with other species as described in the data sheet. AAA Biotech's RANGAP1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the RANGAP1 rangap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PQQRGQGEKS ATPSRKILDP NTGEPAPVLS SPPPADVSTF LAFPSPEKLL RLGPKSSVLI AQQTDTSDPE KVVSAFLKVS SVFKDEATVR MAVQDAVDAL MQKAFNSSSF NSNTFLTRLL VHMGLLKSED KVKAIANLYG PLMALNHMVQ QDYFPKALAP LLLAFVTKPN SALESCSFAR HSLLQTLYKV. It is sometimes possible for the material contained within the vial of "RANGAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.