Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199572_WB11.jpg WB (Western Blot) (WB Suggested Anti-RARB Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit RARB Polyclonal Antibody | anti-RARB antibody

RARB antibody - C-terminal region

Gene Names
RARB; HAP; RRB2; NR1B2; MCOPS12; RARbeta1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RARB, Antibody; RARB antibody - C-terminal region; anti-RARB antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS
Sequence Length
448
Applicable Applications for anti-RARB antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RARB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RARB Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

product-image-AAA199572_WB11.jpg WB (Western Blot) (WB Suggested Anti-RARB Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

WB (Western Blot)

(Host: MouseTarget Name: RARBSample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

product-image-AAA199572_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: RARBSample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Human brainBrain, cortex)

product-image-AAA199572_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Human brainBrain, cortex)
Related Product Information for anti-RARB antibody
This is a rabbit polyclonal antibody against RARB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RARB is a retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants; one additional transcript has been described, but its full length nature has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
retinoic acid receptor beta isoform 1
NCBI Official Synonym Full Names
retinoic acid receptor beta
NCBI Official Symbol
RARB
NCBI Official Synonym Symbols
HAP; RRB2; NR1B2; MCOPS12; RARbeta1
NCBI Protein Information
retinoic acid receptor beta
UniProt Protein Name
Retinoic acid receptor beta
UniProt Gene Name
RARB
UniProt Synonym Gene Names
HAP; NR1B2; RAR-beta
UniProt Entry Name
RARB_HUMAN

Similar Products

Product Notes

The RARB rarb (Catalog #AAA199572) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RARB antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RARB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the RARB rarb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SAKGAERVIT LKMEIPGSMP PLIQEMLENS EGHEPLTPSS SGNTAEHSPS. It is sometimes possible for the material contained within the vial of "RARB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.