Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200088_WB13.jpg WB (Western Blot) (WB Suggested Anti-RB1CC1 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysateRB1CC1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit RB1CC1 Polyclonal Antibody | anti-RB1CC1 antibody

RB1CC1 antibody - C-terminal region

Gene Names
RB1CC1; CC1; ATG17; FIP200; PPP1R131
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
RB1CC1, Antibody; RB1CC1 antibody - C-terminal region; anti-RB1CC1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
Sequence Length
1591
Applicable Applications for anti-RB1CC1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RB1CC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RB1CC1 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysateRB1CC1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

product-image-AAA200088_WB13.jpg WB (Western Blot) (WB Suggested Anti-RB1CC1 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysateRB1CC1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

IHC (Immunohistochemistry)

(Rabbit Anti-RB1CC1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Peripheral membranePrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200088_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-RB1CC1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Peripheral membranePrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-RB1CC1 antibody
This is a rabbit polyclonal antibody against RB1CC1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RB1CC1 is implicated in the regulation of RB1 expression. It functions as a DNA-binding transcription factor. RB1CC1 is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. The expression of RB1CC1 is, thus, a prerequisite for myogenic differentiation. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
183kDa
NCBI Official Full Name
RB1-inducible coiled-coil protein 1 isoform 2
NCBI Official Synonym Full Names
RB1 inducible coiled-coil 1
NCBI Official Symbol
RB1CC1
NCBI Official Synonym Symbols
CC1; ATG17; FIP200; PPP1R131
NCBI Protein Information
RB1-inducible coiled-coil protein 1
UniProt Protein Name
RB1-inducible coiled-coil protein 1
UniProt Gene Name
RB1CC1
UniProt Synonym Gene Names
KIAA0203; RBICC; FIP200
UniProt Entry Name
RBCC1_HUMAN

Similar Products

Product Notes

The RB1CC1 rb1cc1 (Catalog #AAA200088) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RB1CC1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RB1CC1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RB1CC1 rb1cc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGASRRPWVL GKVMEKEYCQ AKKAQNRFKV PLGTKFYRVK AVSWNKKV. It is sometimes possible for the material contained within the vial of "RB1CC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.