Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18718_SDS_PAGE.jpg SDS-PAGE

Proto-oncogene c-Rel (REL) Recombinant Protein | REL recombinant protein

Recombinant Human Proto-oncogene c-Rel (REL), partial

Gene Names
REL; C-Rel
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proto-oncogene c-Rel (REL); N/A; Recombinant Human Proto-oncogene c-Rel (REL), partial; REL recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
3-616aa; Partial
Sequence
SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18718_SDS_PAGE.jpg SDS-PAGE
Related Product Information for REL recombinant protein
Proto-oncogene that may play a role in differentiation and lymphopoiesis. NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with mbers of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator.
Product Categories/Family for REL recombinant protein
References
A human rel proto-oncogene cDNA containing an Alu fragment as a potential coding exon.Brownell E., Mittereder N., Rice N.R.Oncogene 4:935-942(1989) NHLBI resequencing and genotyping service (RS&G) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Genetic characterization of human c-rel sequences.Brownell E., O'Brien S.J., Nash W.G., Rice N.R.Mol. Cell. Biol. 5:2826-2831(1985) A novel complex between the p65 subunit of NF-kappa B and c-Rel binds to a DNA element involved in the phorbol ester induction of the human urokinase gene.Hansen S.K., Nerlov C., Zabel U., Verde P., Johnsen M., Baeuerle P.A., Blasi F.EMBO J. 11:205-213(1992) Activation of multiple NF-kappa B/Rel DNA-binding complexes by tumor necrosis factor.Beg A.A., Baldwin A.S. Jr.Oncogene 9:1487-1492(1994) Regulation of intercellular adhesion molecule-1 gene by tumor necrosis factor-alpha is mediated by the nuclear factor-kappaB heterodimers p65/p65 and p65/c-Rel in the absence of p50.Aoudjit F., Brochu N., Belanger B., Stratowa C., Hiscott J., Audette M.Cell Growth Differ. 8:335-342(1997) A new member of the IkappaB protein family, IkappaB epsilon, inhibits RelA (p65) -mediated NF-kappaB transcription.Li Z., Nabel G.J.Mol. Cell. Biol. 17:6184-6190(1997) Tumor necrosis factor-alpha activation of NF-kappa B requires the phosphorylation of Ser-471 in the transactivation domain of c-Rel.Martin A.G., Fresno M.J. Biol. Chem. 275:24383-24391(2000) Leishmania major amastigotes induce p50/c-Rel NF-kappa B transcription factor in human macrophages involvement in cytokine synthesis.Guizani-Tabbane L., Ben-Aissa K., Belghith M., Sassi A., Dellagi K.Infect. Immun. 72:2582-2589(2004) Inhibition of NF-kappaB activity by IkappaBbeta in association with kappaB-Ras.Chen Y., Vallee S., Wu J., Vu D., Sondek J., Ghosh G.Mol. Cell. Biol. 24:3048-3056(2004) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71.9 kDa
NCBI Official Full Name
proto-oncogene c-Rel isoform 2
NCBI Official Synonym Full Names
v-rel avian reticuloendotheliosis viral oncogene homolog
NCBI Official Symbol
REL
NCBI Official Synonym Symbols
C-Rel
NCBI Protein Information
proto-oncogene c-Rel
UniProt Protein Name
Proto-oncogene c-Rel
UniProt Gene Name
REL
UniProt Entry Name
REL_HUMAN

Similar Products

Product Notes

The REL rel (Catalog #AAA18718) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 3-616aa; Partial. The amino acid sequence is listed below: SGAYNPYIEI IEQPRQRGMR FRYKCEGRSA GSIPGEHSTD NNRTYPSIQI MNYYGKGKVR ITLVTKNDPY KPHPHDLVGK DCRDGYYEAE FGQERRPLFF QNLGIRCVKK KEVKEAIITR IKAGINPFNV PEKQLNDIED CDLNVVRLCF QVFLPDEHGN LTTALPPVVS NPIYDNRAPN TAELRICRVN KNCGSVRGGD EIFLLCDKVQ KDDIEVRFVL NDWEAKGIFS QADVHRQVAI VFKTPPYCKA ITEPVTVKMQ LRRPSDQEVS ESMDFRYLPD EKDTYGNKAK KQKTTLLFQK LCQDHVETGF RHVDQDGLEL LTSGDPPTLA SQSAGITVNF PERPRPGLLG SIGEGRYFKK EPNLFSHDAV VREMPTGVSS QAESYYPSPG PISSGLSHHA SMAPLPSSSW SSVAHPTPRS GNTNPLSSFS TRTLPSNSQG IPPFLRIPVG NDLNASNACI YNNADDIVGM EASSMPSADL YGISDPNMLS NCSVNMMTTS SDSMGETDNP RLLSMNLENP SCNSVLDPRD LRQLHQMSSS SMSAGANSNT TVFVSQSDAF EGSDFSCADN SMINESGPSN STNPNSHGFV QDSQYSGIGS MQNEQLSDSF PYEF . It is sometimes possible for the material contained within the vial of "Proto-oncogene c-Rel (REL), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.