Proto-oncogene c-Rel (REL) Recombinant Protein | REL recombinant protein

Recombinant Human Proto-oncogene c-Rel (REL), partial

Cat. Num. AAA18718

• Gene Names: REL; C-Rel
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Proto-oncogene c-Rel (REL); Recombinant Human Proto-oncogene c-Rel (REL); partial; REL recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 3-616aa; Partial
• Sequence: SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for REL recombinant protein

Proto-oncogene that may play a role in differentiation and lymphopoiesis. NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with mbers of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator.

Product Categories/Family for REL recombinant protein

Transcription

References

A human rel proto-oncogene cDNA containing an Alu fragment as a potential coding exon.Brownell E., Mittereder N., Rice N.R.Oncogene 4:935-942(1989) NHLBI resequencing and genotyping service (RS&G) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Genetic characterization of human c-rel sequences.Brownell E., O'Brien S.J., Nash W.G., Rice N.R.Mol. Cell. Biol. 5:2826-2831(1985) A novel complex between the p65 subunit of NF-kappa B and c-Rel binds to a DNA element involved in the phorbol ester induction of the human urokinase gene.Hansen S.K., Nerlov C., Zabel U., Verde P., Johnsen M., Baeuerle P.A., Blasi F.EMBO J. 11:205-213(1992) Activation of multiple NF-kappa B/Rel DNA-binding complexes by tumor necrosis factor.Beg A.A., Baldwin A.S. Jr.Oncogene 9:1487-1492(1994) Regulation of intercellular adhesion molecule-1 gene by tumor necrosis factor-alpha is mediated by the nuclear factor-kappaB heterodimers p65/p65 and p65/c-Rel in the absence of p50.Aoudjit F., Brochu N., Belanger B., Stratowa C., Hiscott J., Audette M.Cell Growth Differ. 8:335-342(1997) A new member of the IkappaB protein family, IkappaB epsilon, inhibits RelA (p65) -mediated NF-kappaB transcription.Li Z., Nabel G.J.Mol. Cell. Biol. 17:6184-6190(1997) Tumor necrosis factor-alpha activation of NF-kappa B requires the phosphorylation of Ser-471 in the transactivation domain of c-Rel.Martin A.G., Fresno M.J. Biol. Chem. 275:24383-24391(2000) Leishmania major amastigotes induce p50/c-Rel NF-kappa B transcription factor in human macrophages involvement in cytokine synthesis.Guizani-Tabbane L., Ben-Aissa K., Belghith M., Sassi A., Dellagi K.Infect. Immun. 72:2582-2589(2004) Inhibition of NF-kappaB activity by IkappaBbeta in association with kappaB-Ras.Chen Y., Vallee S., Wu J., Vu D., Sondek J., Ghosh G.Mol. Cell. Biol. 24:3048-3056(2004) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)

NCBI and Uniprot Product Information

• NCBI GI #: 619534182
• NCBI GeneID: 5966
• NCBI Accession #: NP_001278675.1
• NCBI GenBank Nucleotide #: NM_001291746.1
• UniProt Accession #: Q04864; Q17RU2; Q2PNZ7; Q6LDY0
• Molecular Weight: 71.9 kDa
• NCBI Official Full Name: proto-oncogene c-Rel isoform 2
• NCBI Official Synonym Full Names: v-rel avian reticuloendotheliosis viral oncogene homolog
• NCBI Official Symbol: REL
• NCBI Official Synonym Symbols: C-Rel
• NCBI Protein Information: proto-oncogene c-Rel
• UniProt Protein Name: Proto-oncogene c-Rel
• UniProt Gene Name: REL
• UniProt Entry Name: REL_HUMAN