Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200559_WB15.jpg WB (Western Blot) (WB Suggested Anti-RGL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit RGL3 Polyclonal Antibody | anti-RGL3 antibody

RGL3 antibody - middle region

Average rating 0.0
No ratings yet
Reactivity
Tested: Human
Predicted: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RGL3, Antibody; RGL3 antibody - middle region; anti-RGL3 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: RNFSSLRAILSALQSNPIYRLKRSWGAVSREPLSTFRKLSQIFSDENNHL
Sequence Length
710
Applicable Applications for anti-RGL3 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RGL3
Protein Size
710 amino acids
Protein Interactions
UBC
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RGL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

product-image-AAA200559_WB15.jpg WB (Western Blot) (WB Suggested Anti-RGL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-RGL3 antibody
Target Description: RGL3 is a guanine nucleotide exchange factor (GEF) for Ral-A. RGL3 is a potential effector of GTPase HRas and Ras-related protein M-Ras. RGL3 negatively regulates Elk-1-dependent gene induction downstream of HRas and MEKK1.
Product Categories/Family for anti-RGL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
ral guanine nucleotide dissociation stimulator-like 3 isoform 2
NCBI Official Synonym Full Names
ral guanine nucleotide dissociation stimulator like 3
NCBI Official Symbol
RGL3
NCBI Protein Information
ral guanine nucleotide dissociation stimulator-like 3
UniProt Protein Name
Ral guanine nucleotide dissociation stimulator-like 3
UniProt Gene Name
RGL3
UniProt Synonym Gene Names
RalGDS-like 3
UniProt Entry Name
RGL3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RGL3 rgl3 (Catalog #AAA200559) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RGL3 antibody - middle region reacts with Tested: Human Predicted: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's RGL3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RGL3 rgl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RNFSSLRAIL SALQSNPIYR LKRSWGAVSR EPLSTFRKLS QIFSDENNHL. It is sometimes possible for the material contained within the vial of "RGL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.