WB (Western Blot)
(RGS9 antibody used at 2 ug/ml to detect target protein.)
Rabbit RGS9 Polyclonal Antibody | anti-RGS9 antibody
RGS9 Antibody
Reactivity
Human, Mouse, Rat, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
RGS9, Antibody; RGS9 Antibody; Rabbit Polyclonal RGS9 Antibody raised against the N terminal of RGS9; Polyclonal RGS9 antibody; Anti-RGS9 antibody; RGS-9; Regulator Of G-Protein Signalling 9 antibody; RGS-9 antibody; RGS9; RGS 9; RGS 9 antibody; anti-RGS9 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
RGS9 antibody was raised against the N terminal of RGS9
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
622
Applicable Applications for anti-RGS9 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
RGS9 antibody was raised using the N terminal of RGS9 corresponding to a region with amino acids MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ
Cross-Reactivity
Human,Mouse,Rat,Dog
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
WB (Western Blot)
(RGS9 antibody used at 2 ug/ml to detect target protein.)
WB (Western Blot)
(RGS9 antibody used at 2 ug/ml to detect target protein.)
IHC (Immunohistochemistry)
(RGS9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.)
IHC (Immunohistochemistry)
(RGS9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.)
Related Product Information for anti-RGS9 antibody
RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.
Product Categories/Family for anti-RGS9 antibody
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
49 kDa (MW of target protein)
NCBI Official Full Name
RGS9, partial
Similar Products
Product Notes
The RGS9 (Catalog #AAA225832) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RGS9 Antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's RGS9 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RGS9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RGS9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.