Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201664_WB13.jpg WB (Western Blot) (WB Suggested Anti-RIPK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit RIPK2 Polyclonal Antibody | anti-RIPK2 antibody

RIPK2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
RIPK2; CCK; RICK; RIP2; CARD3; GIG30; CARDIAK
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
RIPK2, Antibody; RIPK2 antibody - middle region; anti-RIPK2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
Sequence Length
540
Applicable Applications for anti-RIPK2 antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Cow: 85%; Dog: 85%; Guinea Pig: 78%; Horse: 85%; Human: 85%; Mouse: 78%; Rabbit: 84%; Rat: 78%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RIPK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RIPK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA201664_WB13.jpg WB (Western Blot) (WB Suggested Anti-RIPK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

IF (Immunofluorescence)

(Sample Type :Rat thyrocytes-FRTL-5 Primary Antibody Dilution :1:100 Secondary Antibody :Anti-rabbit-Texas Red Secondary Antibody Dilution :1:100 Color/Signal Descriptions :Red: RIPK2Blue: DAPIGene Name :RIPK2Submitted by :Syed A Morshed, Mount Sinai School of Medicine and James J Peters VA Medical Center)

product-image-AAA201664_IF15.jpg IF (Immunofluorescence) (Sample Type :Rat thyrocytes-FRTL-5 Primary Antibody Dilution :1:100 Secondary Antibody :Anti-rabbit-Texas Red Secondary Antibody Dilution :1:100 Color/Signal Descriptions :Red: RIPK2Blue: DAPIGene Name :RIPK2Submitted by :Syed A Morshed, Mount Sinai School of Medicine and James J Peters VA Medical Center)
Related Product Information for anti-RIPK2 antibody
This is a rabbit polyclonal antibody against RIPK2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RIPK2 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. It contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
receptor-interacting serine/threonine-protein kinase 2
NCBI Official Synonym Full Names
receptor interacting serine/threonine kinase 2
NCBI Official Symbol
RIPK2
NCBI Official Synonym Symbols
CCK; RICK; RIP2; CARD3; GIG30; CARDIAK
NCBI Protein Information
receptor-interacting serine/threonine-protein kinase 2
UniProt Protein Name
Receptor-interacting serine/threonine-protein kinase 2
UniProt Gene Name
RIPK2
UniProt Synonym Gene Names
CARDIAK; RICK; RIP2; CARD-containing IL-1 beta ICE-kinase; RIP-2
UniProt Entry Name
RIPK2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RIPK2 ripk2 (Catalog #AAA201664) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIPK2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RIPK2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the RIPK2 ripk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRQERKRPLL DLHIELNGYM YDWNSRVSAK EKYYVWLQHT LRKKLILSYT. It is sometimes possible for the material contained within the vial of "RIPK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.