Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198729_WB13.jpg WB (Western Blot) (WB Suggested Anti-RNASEH2A Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateRNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit RNASEH2A Polyclonal Antibody | anti-RNASEH2A antibody

RNASEH2A antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
RNASEH2A; AGS4; JUNB; RNHL; RNHIA; THSD8; RNASEHI
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
RNASEH2A, Antibody; RNASEH2A antibody - middle region; anti-RNASEH2A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE
Sequence Length
299
Applicable Applications for anti-RNASEH2A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 93%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Yeast: 90%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RNASEH2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RNASEH2A Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateRNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA198729_WB13.jpg WB (Western Blot) (WB Suggested Anti-RNASEH2A Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateRNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemistry)

(Rabbit Anti-RNASEH2A AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198729_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-RNASEH2A AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-RNASEH2A antibody
This is a rabbit polyclonal antibody against RNASEH2A. It was validated on Western Blot and immunohistochemistry

Target Description: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.
Product Categories/Family for anti-RNASEH2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
ribonuclease H2 subunit A
NCBI Official Synonym Full Names
ribonuclease H2 subunit A
NCBI Official Symbol
RNASEH2A
NCBI Official Synonym Symbols
AGS4; JUNB; RNHL; RNHIA; THSD8; RNASEHI
NCBI Protein Information
ribonuclease H2 subunit A
UniProt Protein Name
Ribonuclease H2 subunit A
UniProt Gene Name
RNASEH2A
UniProt Synonym Gene Names
RNASEHI; RNHIA; RNase H2 subunit A; AGS4; RNase HI large subunit
UniProt Entry Name
RNH2A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RNASEH2A rnaseh2a (Catalog #AAA198729) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNASEH2A antibody - middle region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RNASEH2A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the RNASEH2A rnaseh2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQTILEKEAE DVIWEDSASE NQEGLRKITS YFLNEGSQAR PRSSHRYFLE. It is sometimes possible for the material contained within the vial of "RNASEH2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.