Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA108397_WB13.jpg WB (Western Blot) (RNF121 antibody (AAA108397) used at 1.25 ug/ml to detect target protein.)

Rabbit RNF121 Polyclonal Antibody | anti-RNF121 antibody

RNF121 antibody

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Rat, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
RNF121, Antibody; RNF121 antibody; Polyclonal RNF121; Anti-RNF121; RNF 121; RNF121; Ring Finger Protein 121; RNF-121; FLJ11099; anti-RNF121 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
RNF121 antibody was raised against the N terminal of RNF121
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RNF121 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
327
Applicable Applications for anti-RNF121 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
The protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

WB (Western Blot)

(RNF121 antibody (AAA108397) used at 1.25 ug/ml to detect target protein.)

product-image-AAA108397_WB13.jpg WB (Western Blot) (RNF121 antibody (AAA108397) used at 1.25 ug/ml to detect target protein.)

IHC (Immunohistochemistry)

(RNF121 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X)

product-image-AAA108397_IHC15.jpg IHC (Immunohistochemistry) (RNF121 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X)
Related Product Information for anti-RNF121 antibody
Rabbit polyclonal RNF121 antibody raised against the N terminal of RNF121
Product Categories/Family for anti-RNF121 antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
32 kDa (MW of target protein)
NCBI Official Full Name
RNF121
UniProt Protein Name
RING finger protein 121
UniProt Gene Name
RNF121
UniProt Entry Name
RN121_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RNF121 rnf121 (Catalog #AAA108397) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF121 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's RNF121 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RNF121 rnf121 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RNF121, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.