Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200950_WB8.jpg WB (Western Blot) (WB Suggested Anti-Rnls AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Rabbit Rnls Polyclonal Antibody | anti-RNLS antibody

Rnls antibody - middle region

Gene Names
Rnls; AI452315; AW060440; C10orf59; 6530404N21Rik
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Rnls, Antibody; Rnls antibody - middle region; anti-RNLS antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV
Sequence Length
300
Applicable Applications for anti-RNLS antibody
WB (Western Blot)
Homology
Dog: 79%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Rnls AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

product-image-AAA200950_WB8.jpg WB (Western Blot) (WB Suggested Anti-Rnls AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

WB (Western Blot)

(WB Suggested Anti-Rnls AntibodyPositive Control: Lane 1: 40ug Mouse N2a cell lysateLane 2: 40ug Mouse N2a cell lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2500Submitted by: Nitish R Mahapatra, IIT Madras)

product-image-AAA200950_WB10.jpg WB (Western Blot) (WB Suggested Anti-Rnls AntibodyPositive Control: Lane 1: 40ug Mouse N2a cell lysateLane 2: 40ug Mouse N2a cell lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2500Submitted by: Nitish R Mahapatra, IIT Madras)

WB (Western Blot)

(WB Suggested Anti-Rnls AntibodyPositive Control: Lane 1: 40ug Mouse liver tissue lysateLane 2: 40ug Mouse liver tissue lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2500Submitted by: Nitish R Mahapatra, IIT Madras)

product-image-AAA200950_WB11.jpg WB (Western Blot) (WB Suggested Anti-Rnls AntibodyPositive Control: Lane 1: 40ug Mouse liver tissue lysateLane 2: 40ug Mouse liver tissue lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2500Submitted by: Nitish R Mahapatra, IIT Madras)

WB (Western Blot)

(WB Suggested Anti-Rnls AntibodyPositive Control: Lane 1: 40ug Mouse kidney tissue lysateLane 2: 40ug Mouse kidney tissue lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2500Submitted by: Nitish R Mahapatra, IIT Madras)

product-image-AAA200950_WB13.jpg WB (Western Blot) (WB Suggested Anti-Rnls AntibodyPositive Control: Lane 1: 40ug Mouse kidney tissue lysateLane 2: 40ug Mouse kidney tissue lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2500Submitted by: Nitish R Mahapatra, IIT Madras)

WB (Western Blot)

(Host: RabbitTarget Name: RnlsSample Tissue: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA200950_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: RnlsSample Tissue: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RNLS antibody
This is a rabbit polyclonal antibody against Rnls. It was validated on Western Blot

Target Description: Rnls is a probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. It degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. It lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis.
Product Categories/Family for anti-RNLS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
renalase isoform 1
NCBI Official Synonym Full Names
renalase, FAD-dependent amine oxidase
NCBI Official Symbol
Rnls
NCBI Official Synonym Symbols
AI452315; AW060440; C10orf59; 6530404N21Rik
NCBI Protein Information
renalase
UniProt Protein Name
Renalase
UniProt Gene Name
Rnls
UniProt Synonym Gene Names
MAO-C; mMAO-C

Similar Products

Product Notes

The RNLS rnls (Catalog #AAA200950) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rnls antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Rnls can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RNLS rnls for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GMKIGVPWSC RYLSSHPCIC FISIDNKKRN IESSECGPSV VIQTTVPFGV. It is sometimes possible for the material contained within the vial of "Rnls, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.