Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281806_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse spleen using RPL31 antibody at dilution of 1:100 (40x lens).)

Rabbit RPL31 Polyclonal Antibody | anti-RPL31 antibody

RPL31 Rabbit pAb

Gene Names
RPL31; L31
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
RPL31, Antibody; RPL31 Rabbit pAb; L31; RPL31; anti-RPL31 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
KKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTL
Applicable Applications for anti-RPL31 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 5-105 of human RPL31 (NP_000984.1).
Positive Samples
HeLa, HepG2, Mouse spleen, Mouse brain, Mouse liver, Rat spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse spleen using RPL31 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281806_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse spleen using RPL31 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat kidney using RPL31 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281806_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat kidney using RPL31 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using RPL31 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281806_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using RPL31 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-RPL31 antibody
Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L31E family of ribosomal proteins. It is located in the cytoplasm. Higher levels of expression of this gene in familial adenomatous polyps compared to matched normal tissues have been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Product Categories/Family for anti-RPL31 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,463 Da
NCBI Official Full Name
60S ribosomal protein L31 isoform 1
NCBI Official Synonym Full Names
ribosomal protein L31
NCBI Official Symbol
RPL31
NCBI Official Synonym Symbols
L31
NCBI Protein Information
60S ribosomal protein L31
UniProt Protein Name
60S ribosomal protein L31
UniProt Gene Name
RPL31
UniProt Entry Name
RL31_HUMAN

Similar Products

Product Notes

The RPL31 rpl31 (Catalog #AAA281806) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPL31 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RPL31 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RPL31 rpl31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KKGGEKKKGR SAINEVVTRE YTINIHKRIH GVGFKKRAPR ALKEIRKFAM KEMGTPDVRI DTRLNKAVWA KGIRNVPYRI RVRLSRKRNE DEDSPNKLYT L. It is sometimes possible for the material contained within the vial of "RPL31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.