Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23596_WB7.jpg WB (Western Blot) (WB Suggested Anti-RPL36AL AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellRPL36AL is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit RPL36AL Polyclonal Antibody | anti-RPL36AL antibody

RPL36AL Antibody - C-terminal region

Gene Names
RPL36AL; RPL36A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RPL36AL, Antibody; RPL36AL Antibody - C-terminal region; anti-RPL36AL antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQ
Sequence Length
106
Applicable Applications for anti-RPL36AL antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL36AL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RPL36AL AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellRPL36AL is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA23596_WB7.jpg WB (Western Blot) (WB Suggested Anti-RPL36AL AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellRPL36AL is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: RPL36ASample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23596_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: RPL36ASample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RPL36ASample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23596_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: RPL36ASample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RPL36ASample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA23596_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: RPL36ASample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RPL36ASample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23596_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: RPL36ASample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RPL36ASample Type: Human 721_BAntibody Dilution: 1.0ug/mlRPL36AL is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA23596_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: RPL36ASample Type: Human 721_BAntibody Dilution: 1.0ug/mlRPL36AL is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: RPL36ASample Type: Human 293TAntibody Dilution: 1.0ug/mlRPL36AL is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA23596_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: RPL36ASample Type: Human 293TAntibody Dilution: 1.0ug/mlRPL36AL is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-RPL36AL antibody
This is a rabbit polyclonal antibody against RPL36AL. It was validated on Western Blot

Target Description: Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which shares sequence similarity with yeast ribosomal protein L44, belongs to the L44E (L36AE) family of ribosomal proteins. This gene and the human gene officially named ribosomal protein L36a (RPL36A) encode nearly identical proteins; however, they are distinct genes. Although the name of this gene has been referred to as ribosomal protein L36a (RPL36A), its official name is ribosomal protein L36a-like (RPL36AL). As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product Categories/Family for anti-RPL36AL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
60S ribosomal protein L36a-like
NCBI Official Synonym Full Names
ribosomal protein L36a like
NCBI Official Symbol
RPL36AL
NCBI Official Synonym Symbols
RPL36A
NCBI Protein Information
60S ribosomal protein L36a-like
UniProt Protein Name
60S ribosomal protein L36a-like
UniProt Gene Name
RPL36AL
UniProt Entry Name
RL36L_HUMAN

Similar Products

Product Notes

The RPL36AL rpl36al (Catalog #AAA23596) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPL36AL Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RPL36AL can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RPL36AL rpl36al for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FRKKAKTTKK IVLRLECVEP NCRSKRMLAI KRCKHFELGG DKKRKGQVIQ. It is sometimes possible for the material contained within the vial of "RPL36AL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.