Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197347_WB10.jpg WB (Western Blot) (WB Suggested Anti-RUVBL2 Antibody Titration: 2.0-4.0ug/mlPositive Control: Daudi cell lysateRUVBL2 is supported by BioGPS gene expression data to be expressed in Daudi)

Rabbit RUVBL2 Polyclonal Antibody | anti-RUVBL2 antibody

RUVBL2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
RUVBL2; RVB2; TIH2; ECP51; TIP48; CGI-46; ECP-51; INO80J; REPTIN; TIP49B; TAP54-beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
RUVBL2, Antibody; RUVBL2 antibody - N-terminal region; anti-RUVBL2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKI
Sequence Length
463
Applicable Applications for anti-RUVBL2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RUVBL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RUVBL2 Antibody Titration: 2.0-4.0ug/mlPositive Control: Daudi cell lysateRUVBL2 is supported by BioGPS gene expression data to be expressed in Daudi)

product-image-AAA197347_WB10.jpg WB (Western Blot) (WB Suggested Anti-RUVBL2 Antibody Titration: 2.0-4.0ug/mlPositive Control: Daudi cell lysateRUVBL2 is supported by BioGPS gene expression data to be expressed in Daudi)

WB (Western Blot)

(Sample Type :Lane 1: 20ug untransfected H1299 cells Lane 2: 20ug siRUVBL2 transfected H1299 cells Primary Antibody Dilution :1:1000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:3000 Color/Signal Descriptions:RUVBL2 Gene Name:Wenwei Hu, Xuetian Yue, Rutgers Cancer Institute of New Jersey. Submitted by:)

product-image-AAA197347_WB11.jpg WB (Western Blot) (Sample Type :Lane 1: 20ug untransfected H1299 cells Lane 2: 20ug siRUVBL2 transfected H1299 cells Primary Antibody Dilution :1:1000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:3000 Color/Signal Descriptions:RUVBL2 Gene Name:Wenwei Hu, Xuetian Yue, Rutgers Cancer Institute of New Jersey. Submitted by:)

IHC (Immunohiostchemistry)

(Human urinary bladder)

product-image-AAA197347_IHC13.jpg IHC (Immunohiostchemistry) (Human urinary bladder)

IHC (Immunohistochemistry)

(Human Lung)

product-image-AAA197347_IHC15.jpg IHC (Immunohistochemistry) (Human Lung)
Related Product Information for anti-RUVBL2 antibody
This is a rabbit polyclonal antibody against RUVBL2. It was validated on Western Blot and immunohistochemistry

Target Description: RuvB-Like 2 (48-kDa TATA box-binding protein-interacting protein, Reptin 52, RUVBL2) is the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this protein has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
ruvB-like 2 isoform 1
NCBI Official Synonym Full Names
RuvB like AAA ATPase 2
NCBI Official Symbol
RUVBL2
NCBI Official Synonym Symbols
RVB2; TIH2; ECP51; TIP48; CGI-46; ECP-51; INO80J; REPTIN; TIP49B; TAP54-beta
NCBI Protein Information
ruvB-like 2
UniProt Protein Name
RuvB-like 2
UniProt Gene Name
RUVBL2
UniProt Synonym Gene Names
INO80J; TIP48; TIP49B; 48 kDa TBP-interacting protein; ECP-51; Reptin 52; TAP54-beta
UniProt Entry Name
RUVB2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RUVBL2 ruvbl2 (Catalog #AAA197347) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RUVBL2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RUVBL2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the RUVBL2 ruvbl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IERIGAHSHI RGLGLDDALE PRQASQGMVG QLAARRAAGV VLEMIREGKI. It is sometimes possible for the material contained within the vial of "RUVBL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.