Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282271_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human tonsil using S100A7/Psoriasin Rabbit pAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Rabbit S100A7/Psoriasin Polyclonal Antibody | anti-S100A7 antibody

S100A7/Psoriasin Rabbit pAb

Gene Names
SORD; SORD1; HEL-S-95n
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry
Purity
Affinity purification
Synonyms
S100A7/Psoriasin, Antibody; S100A7/Psoriasin Rabbit pAb; S100A7; PSOR1; S100A7c; anti-S100A7 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
RENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQV
Applicable Applications for anti-S100A7 antibody
IHC (Immunohistochemistry)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 2-101 of human S100A7/Psoriasin (NP_002954.2).
Cellular Location
cytoplasm, cytosol, endoplasmic reticulum, extracellular region, extracellular space, focal adhesion, nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human tonsil using S100A7/Psoriasin Rabbit pAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282271_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human tonsil using S100A7/Psoriasin Rabbit pAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human cervix cancer using S100A7/Psoriasin Rabbit pAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282271_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human cervix cancer using S100A7/Psoriasin Rabbit pAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
Related Product Information for anti-S100A7 antibody
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
357
NCBI Official Full Name
Sorbitol dehydrogenase
NCBI Official Synonym Full Names
sorbitol dehydrogenase
NCBI Official Symbol
SORD
NCBI Official Synonym Symbols
SORD1; HEL-S-95n
NCBI Protein Information
sorbitol dehydrogenase; L-iditol 2-dehydrogenase; epididymis secretory sperm binding protein Li 95n
UniProt Protein Name
Sorbitol dehydrogenase
UniProt Gene Name
SORD
UniProt Entry Name
DHSO_HUMAN

Similar Products

Product Notes

The S100A7 sord (Catalog #AAA282271) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A7/Psoriasin Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's S100A7/Psoriasin can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the S100A7 sord for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RENDEFCKMG RYNLSPSIFF CATPPDDGNL CRFYKHNAAF CYKLPDNVTF EEGALIEPLS VGIHACRRGG VTLGHKVLVC GAGPIGMVTL LVAKAMGAAQ V. It is sometimes possible for the material contained within the vial of "S100A7/Psoriasin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.