Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283298_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using S100a9 Rabbit pAb (AAA283298) at a dilution of  1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit anti-Mouse S100a9 Polyclonal Antibody | anti-S100a9 antibody

S100a9 Rabbit pAb

Reactivity
Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
S100a9, Antibody; S100a9 Rabbit pAb; p14; Cagb; GAGB; L1Ag; BEE22; MRP14; 60B8Ag; anti-S100a9 antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
Applicable Applications for anti-S100a9 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of mouse S100a9 (NP_033140.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using S100a9 Rabbit pAb (AAA283298) at a dilution of  1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA283298_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using S100a9 Rabbit pAb (AAA283298) at a dilution of  1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using S100a9 Rabbit pAb (AAA283298) at a dilution of  1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA283298_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using S100a9 Rabbit pAb (AAA283298) at a dilution of  1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse spleen using S100a9 Rabbit pAb (AAA283298) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA283298_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse spleen using S100a9 Rabbit pAb (AAA283298) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-S100a9 antibody
Predicted to enable calcium ion binding activity and calcium-dependent protein binding activity. Involved in peptidyl-cysteine S-nitrosylation; positive regulation of blood coagulation; and regulation of translation. Acts upstream of or within several processes, including actin cytoskeleton reorganization; astrocyte development; and regulation of integrin biosynthetic process. Predicted to be located in cell junction; cytosol; and nucleoplasm. Predicted to be active in cytoplasm; extracellular space; and nucleus. Is expressed in several structures, including jaw; liver; otic capsule; skeleton; and spleen red pulp. Human ortholog(s) of this gene implicated in myocarditis. Orthologous to human S100A9 (S100 calcium binding protein A9).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 13kDa
Observed MW: 13kDa
UniProt Protein Name
Protein S100-A9
UniProt Gene Name
S100a9
UniProt Synonym Gene Names
Cagb; Mrp14; MRP-14; p14
UniProt Entry Name
S10A9_MOUSE

Similar Products

Product Notes

The S100a9 s100a9 (Catalog #AAA283298) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100a9 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's S100a9 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the S100a9 s100a9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MANKAPSQME RSITTIIDTF HQYSRKEGHP DTLSKKEFRQ MVEAQLATFM KKEKRNEALI NDIMEDLDTN QDNQLSFEEC MMLMAKLIFA CHEKLHENNP RGHGHSHGKG CGK. It is sometimes possible for the material contained within the vial of "S100a9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.