Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200325_WB10.jpg WB (Western Blot) (WB Suggested Anti-SAMD4A Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit SAMD4A Polyclonal Antibody | anti-SAMD4A antibody

SAMD4A antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
SAMD4A; SMG; SMGA; SAMD4; SMAUG; SMAUG1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SAMD4A, Antibody; SAMD4A antibody - middle region; anti-SAMD4A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK
Sequence Length
717
Applicable Applications for anti-SAMD4A antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SAMD4A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SAMD4A Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

product-image-AAA200325_WB10.jpg WB (Western Blot) (WB Suggested Anti-SAMD4A Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

WB (Western Blot)

(Host: RabbitTarget Name: SAMD4ASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA200325_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SAMD4ASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SAMD4ASample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA200325_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SAMD4ASample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SAMD4ASample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200325_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SAMD4ASample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-SAMD4A antibody
This is a rabbit polyclonal antibody against SAMD4A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein (Baez and Boccaccio, 2005 [PubMed 16221671]).[supplied by OMIM].
Product Categories/Family for anti-SAMD4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79kDa
NCBI Official Full Name
protein Smaug homolog 1 isoform 1
NCBI Official Synonym Full Names
sterile alpha motif domain containing 4A
NCBI Official Symbol
SAMD4A
NCBI Official Synonym Symbols
SMG; SMGA; SAMD4; SMAUG; SMAUG1
NCBI Protein Information
protein Smaug homolog 1
UniProt Protein Name
Protein Smaug homolog 1
UniProt Gene Name
SAMD4A
UniProt Synonym Gene Names
KIAA1053; SAMD4; SMAUG1; Smaug 1; hSmaug1
UniProt Entry Name
SMAG1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SAMD4A samd4a (Catalog #AAA200325) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAMD4A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SAMD4A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SAMD4A samd4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKSLRLHKYA ALFSQMTYEE MMALTECQLE AQNVTKGARH KIVISIQKLK. It is sometimes possible for the material contained within the vial of "SAMD4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.