Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199461_WB13.jpg WB (Western Blot) (WB Suggested Anti-SDCBP Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Rabbit SDCBP Polyclonal Antibody | anti-SDCBP antibody

SDCBP antibody - middle region

Gene Names
SDCBP; ST1; MDA9; SYCL; MDA-9; TACIP18
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SDCBP, Antibody; SDCBP antibody - middle region; anti-SDCBP antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV
Sequence Length
298
Applicable Applications for anti-SDCBP antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SDCBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SDCBP Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA199461_WB13.jpg WB (Western Blot) (WB Suggested Anti-SDCBP Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA199461_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-SDCBP antibody
This is a rabbit polyclonal antibody against SDCBP. It was validated on Western Blot and immunohistochemistry

Target Description: SDCBP was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
syntenin-1 isoform 1
NCBI Official Synonym Full Names
syndecan binding protein
NCBI Official Symbol
SDCBP
NCBI Official Synonym Symbols
ST1; MDA9; SYCL; MDA-9; TACIP18
NCBI Protein Information
syntenin-1
UniProt Protein Name
Syntenin-1
UniProt Gene Name
SDCBP
UniProt Synonym Gene Names
MDA9; SYCL; MDA-9; TACIP18
UniProt Entry Name
SDCB1_HUMAN

Similar Products

Product Notes

The SDCBP sdcbp (Catalog #AAA199461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SDCBP antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SDCBP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SDCBP sdcbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGIRRAEIKQ GIREVILCKD QDGKIGLRLK SIDNGIFVQL VQANSPASLV. It is sometimes possible for the material contained within the vial of "SDCBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.