Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201329_WB11.jpg WB (Western Blot) (WB Suggested Anti-SEC61A1 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellSEC61A1 is supported by BioGPS gene expression data to be expressed in HT1080)

Rabbit SEC61A1 Polyclonal Antibody | anti-SEC61A1 antibody

SEC61A1 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
SEC61A1; HNFJ4; SEC61; HSEC61; SEC61A
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SEC61A1, Antibody; SEC61A1 Antibody - C-terminal region; anti-SEC61A1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC
Sequence Length
476
Applicable Applications for anti-SEC61A1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEC61A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SEC61A1 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellSEC61A1 is supported by BioGPS gene expression data to be expressed in HT1080)

product-image-AAA201329_WB11.jpg WB (Western Blot) (WB Suggested Anti-SEC61A1 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellSEC61A1 is supported by BioGPS gene expression data to be expressed in HT1080)

WB (Western Blot)

(Host: RabbitTarget Name: SEC61A1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA201329_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SEC61A1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SEC61A1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA201329_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SEC61A1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SEC61A1 antibody
This is a rabbit polyclonal antibody against SEC61A1. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the SECY/SEC61- alpha family. It appears to play a crucial role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum. This protein found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins. This gene encodes an alpha subunit of the heteromeric SEC61 complex, which also contains beta and gamma subunits.
Product Categories/Family for anti-SEC61A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
protein transport protein Sec61 subunit alpha isoform 1
NCBI Official Synonym Full Names
Sec61 translocon alpha 1 subunit
NCBI Official Symbol
SEC61A1
NCBI Official Synonym Symbols
HNFJ4; SEC61; HSEC61; SEC61A
NCBI Protein Information
protein transport protein Sec61 subunit alpha isoform 1
UniProt Protein Name
Protein transport protein Sec61 subunit alpha isoform 1
UniProt Gene Name
SEC61A1
UniProt Synonym Gene Names
SEC61A; Sec61 alpha-1
UniProt Entry Name
S61A1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SEC61A1 sec61a1 (Catalog #AAA201329) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEC61A1 Antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SEC61A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SEC61A1 sec61a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TWIEVSGSSA KDVAKQLKEQ QMVMRGHRET SMVHELNRYI PTAAAFGGLC. It is sometimes possible for the material contained within the vial of "SEC61A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.