WB (Western Blot)
(WB Suggested Anti-SFRS7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)
Rabbit SFRS7 Polyclonal Antibody | anti-SRSF7 antibody
SFRS7 antibody - N-terminal region
Gene Names
SRSF7; 9G8; AAG3; SFRS7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SFRS7, Antibody; SFRS7 antibody - N-terminal region; anti-SRSF7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA
Sequence Length
238
Applicable Applications for anti-SRSF7 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SFRS7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)
WB (Western Blot)
(WB Suggested Anti-SFRS7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)
IHC (Immunohiostchemistry)
(Rabbit Anti-SFRS7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human PlacentaPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
IHC (Immunohiostchemistry)
(Rabbit Anti-SFRS7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human PlacentaPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
IHC (Immunohistochemistry)
(Rabbit Anti-SFRS7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
IHC (Immunohistochemistry)
(Rabbit Anti-SFRS7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-SRSF7 antibody
This is a rabbit polyclonal antibody against SFRS7. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.
Target Description: SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.
Product Categories/Family for anti-SRSF7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
serine/arginine-rich splicing factor 7 isoform 1
NCBI Official Synonym Full Names
serine and arginine rich splicing factor 7
NCBI Official Symbol
SRSF7
NCBI Official Synonym Symbols
9G8; AAG3; SFRS7
NCBI Protein Information
serine/arginine-rich splicing factor 7
UniProt Protein Name
Serine/arginine-rich splicing factor 7
UniProt Gene Name
SRSF7
UniProt Synonym Gene Names
SFRS7
UniProt Entry Name
SRSF7_HUMAN
Similar Products
Product Notes
The SRSF7 srsf7 (Catalog #AAA200556) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SFRS7 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SFRS7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SRSF7 srsf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSRYGRYGGE TKVYVGNLGT GAGKGELERA FSYYGPLRTV WIARNPPGFA. It is sometimes possible for the material contained within the vial of "SFRS7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.