WB (Western Blot)
(WB Suggested Anti-SGK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: SH-SYSY cell lysate)
Rabbit SGK3 Polyclonal Antibody | anti-SGK3 antibody
SGK3 antibody - N-terminal region
Gene Names
SGK3; CISK; SGK2; SGKL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SGK3, Antibody; SGK3 antibody - N-terminal region; anti-SGK3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH
Sequence Length
464
Applicable Applications for anti-SGK3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SGK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SGK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: SH-SYSY cell lysate)
WB (Western Blot)
(WB Suggested Anti-SGK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: SH-SYSY cell lysate)
IHC (Immunohistochemistry)
(Spleen)
IHC (Immunohistochemistry)
(Spleen)
Related Product Information for anti-SGK3 antibody
This is a rabbit polyclonal antibody against SGK3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The specific function of the protein remains unknown.This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Target Description: The specific function of the protein remains unknown.This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-SGK3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53kDa
NCBI Official Full Name
serine/threonine-protein kinase Sgk3 isoform 2
NCBI Official Synonym Full Names
serum/glucocorticoid regulated kinase family member 3
NCBI Official Symbol
SGK3
NCBI Official Synonym Symbols
CISK; SGK2; SGKL
NCBI Protein Information
serine/threonine-protein kinase Sgk3
Similar Products
Product Notes
The SGK3 (Catalog #AAA200517) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SGK3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SGK3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SGK3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LYNHPDVRAF LQMDSPKHQS DPSEDEDERS SQKLHSTSQN INLGPSGNPH. It is sometimes possible for the material contained within the vial of "SGK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.