Rabbit SGPP2 Polyclonal Antibody | anti-SGPP2 antibody
SGPP2 Antibody
Gene Names
SGPP2; SPP2; SPPase2
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
SGPP2, Antibody; SGPP2 Antibody; Rabbit Polyclonal SGPP2 Antibody raised against the C terminal of SGPP2; Polyclonal SGPP2 antibody; Anti-SGPP2 antibody; SPP2 antibody; SGPP-2; FLJ39004 antibody; Sphingosine-1-Phosphate Phosphotase 2 antibody; SGPP2; SGPP-2 antibody; SGPP 2 antibody; SGPP 2; anti-SGPP2 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
SGPP2 antibody was raised against the C terminal of SGPP2
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
271
Applicable Applications for anti-SGPP2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
SGPP2 antibody was raised using the C terminal of SGPP2 corresponding to a region with amino acids SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL
Cross-Reactivity
Human
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-SGPP2 antibody
In vitro, SGPP2 has high phosphohydrolase activity against dihydrosphingosine-1-phosphate and sphingosine-1-phosphate (S1P).
Product Categories/Family for anti-SGPP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa (MW of target protein)
NCBI Official Full Name
sphingosine-1-phosphate phosphatase 2 isoform b
NCBI Official Synonym Full Names
sphingosine-1-phosphate phosphatase 2
NCBI Official Symbol
SGPP2
NCBI Official Synonym Symbols
SPP2; SPPase2
NCBI Protein Information
sphingosine-1-phosphate phosphatase 2
UniProt Protein Name
Sphingosine-1-phosphate phosphatase 2
UniProt Gene Name
SGPP2
UniProt Synonym Gene Names
SPPase2; Spp2; hSPP2
UniProt Entry Name
SGPP2_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The SGPP2 sgpp2 (Catalog #AAA225054) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SGPP2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SGPP2 sgpp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGPP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
