Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200278_WB8.jpg WB (Western Blot) (WB Suggested Anti-SH2D3C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit SH2D3C Polyclonal Antibody | anti-SH2D3C antibody

SH2D3C antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SH2D3C; CHAT; NSP3; SHEP1; PRO34088
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SH2D3C, Antibody; SH2D3C antibody - N-terminal region; anti-SH2D3C antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE
Sequence Length
703
Applicable Applications for anti-SH2D3C antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SH2D3C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SH2D3C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

product-image-AAA200278_WB8.jpg WB (Western Blot) (WB Suggested Anti-SH2D3C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: SH2D3CSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA200278_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: SH2D3CSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SH2D3CSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200278_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SH2D3CSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SH2D3CSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA200278_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SH2D3CSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SH2D3CSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA200278_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SH2D3CSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SH2D3C antibody
This is a rabbit polyclonal antibody against SH2D3C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SH2D3C is an Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 of SH2D3C is required to induce membrane ruffling and promote EGF-dependent cell migration.
Product Categories/Family for anti-SH2D3C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
SH2 domain-containing protein 3C isoform a
NCBI Official Synonym Full Names
SH2 domain containing 3C
NCBI Official Symbol
SH2D3C
NCBI Official Synonym Symbols
CHAT; NSP3; SHEP1; PRO34088
NCBI Protein Information
SH2 domain-containing protein 3C
UniProt Protein Name
SH2 domain-containing protein 3C
UniProt Gene Name
SH2D3C
UniProt Synonym Gene Names
NSP3; SHEP1
UniProt Entry Name
SH2D3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SH2D3C sh2d3c (Catalog #AAA200278) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SH2D3C antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SH2D3C can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SH2D3C sh2d3c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGSDYVKFSK EKYILDSSPE KLHKELEEEL KLSSTDLRSH AWYHGRIPRE. It is sometimes possible for the material contained within the vial of "SH2D3C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.