Rabbit SIM1 Polyclonal Antibody | anti-SIM1 antibody
SIM1 Antibody - middle region
Gene Names
SIM1; bHLHe14
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry
Purity
Affinity Purified
Synonyms
SIM1, Antibody; SIM1 Antibody - middle region; anti-SIM1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPADR
Sequence Length
766
Applicable Applications for anti-SIM1 antibody
IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human SIM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-SIM1 antibody
This is a rabbit polyclonal antibody against SIM1. It was validated on Western Blot
Target Description: SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. SIM1 transcript was detected only in fetal kidney out of various adult and fetal tissues tested. Since the sim gene plays an important role in Drosophila development and has peak levels of expression during the period of neurogenesis,it was proposed that the human SIM gene is a candidate for involvement in certain dysmorphic features (particularly the facial and skull characteristics), abnormalities of brain development, and/or mental retardation of Down syndrome.
Target Description: SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. SIM1 transcript was detected only in fetal kidney out of various adult and fetal tissues tested. Since the sim gene plays an important role in Drosophila development and has peak levels of expression during the period of neurogenesis,it was proposed that the human SIM gene is a candidate for involvement in certain dysmorphic features (particularly the facial and skull characteristics), abnormalities of brain development, and/or mental retardation of Down syndrome.
Product Categories/Family for anti-SIM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
single-minded homolog 1
NCBI Official Synonym Full Names
SIM bHLH transcription factor 1
NCBI Official Symbol
SIM1
NCBI Official Synonym Symbols
bHLHe14
NCBI Protein Information
single-minded homolog 1
UniProt Protein Name
Single-minded homolog 1
UniProt Gene Name
SIM1
UniProt Synonym Gene Names
BHLHE14; bHLHe14
UniProt Entry Name
SIM1_HUMAN
Similar Products
Product Notes
The SIM1 sim1 (Catalog #AAA197557) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIM1 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SIM1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SIM1 sim1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSSKSKSRTS PYPQYSGFHT ERSESDHDSQ WGGSPLTDTA SPQLLDPADR. It is sometimes possible for the material contained within the vial of "SIM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
