Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201506_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SIR3Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SIRT3 Polyclonal Antibody | anti-SIRT3 antibody

SIRT3 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SIRT3; SIR2L3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SIRT3, Antibody; SIRT3 Antibody - N-terminal region; anti-SIRT3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDKGKLSLQDVAELIRA
Sequence Length
399
Applicable Applications for anti-SIRT3 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SIR3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: SIR3Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201506_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SIR3Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SIR3Sample Type: Fetal Liver lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201506_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SIR3Sample Type: Fetal Liver lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SIRT3 antibody
This is a rabbit polyclonal antibody against SIR3. It was validated on Western Blot

Target Description: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene.
Product Categories/Family for anti-SIRT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
NAD-dependent protein deacetylase sirtuin-3, mitochondrial isoform a
NCBI Official Synonym Full Names
sirtuin 3
NCBI Official Symbol
SIRT3
NCBI Official Synonym Symbols
SIR2L3
NCBI Protein Information
NAD-dependent protein deacetylase sirtuin-3, mitochondrial
UniProt Protein Name
NAD-dependent protein deacetylase sirtuin-3, mitochondrial
UniProt Gene Name
SIRT3
UniProt Synonym Gene Names
SIR2L3; hSIRT3
UniProt Entry Name
SIR3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SIRT3 sirt3 (Catalog #AAA201506) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIRT3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SIRT3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SIRT3 sirt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAAPSFFFSS IKGGRRSISF SVGASSVVGS GGSSDKGKLS LQDVAELIRA. It is sometimes possible for the material contained within the vial of "SIRT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.