Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197322_WB11.jpg WB (Western Blot) (WB Suggested Anti-SKIIP Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateSNW1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit SKIIP Polyclonal Antibody | anti-SNW1 antibody

SKIIP antibody - N-terminal region

Gene Names
SNW1; Bx42; SKIP; FUN20; Prp45; SKIIP; SKIP1; PRPF45; NCOA-62
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SKIIP, Antibody; SKIIP antibody - N-terminal region; anti-SNW1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE
Sequence Length
536
Applicable Applications for anti-SNW1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SKIIP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SKIIP Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateSNW1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA197322_WB11.jpg WB (Western Blot) (WB Suggested Anti-SKIIP Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateSNW1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

IHC (Immunohiostchemistry)

(Rabbit Anti-SKIIP antibodyParaffin Embedded Tissue: Human Lung cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197322_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-SKIIP antibodyParaffin Embedded Tissue: Human Lung cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Human Intestine)

product-image-AAA197322_IHC15.jpg IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-SNW1 antibody
This is a rabbit polyclonal antibody against SKIIP. It was validated on Western Blot and immunohistochemistry

Target Description: SKIIP (Nuclear Protein SkiP, nuclear receptor coactivator NCoA-62, ski-interacting protein) is a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also interact with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
SNW domain-containing protein 1 isoform 2
NCBI Official Synonym Full Names
SNW domain containing 1
NCBI Official Symbol
SNW1
NCBI Official Synonym Symbols
Bx42; SKIP; FUN20; Prp45; SKIIP; SKIP1; PRPF45; NCOA-62
NCBI Protein Information
SNW domain-containing protein 1
UniProt Protein Name
SNW domain-containing protein 1
UniProt Gene Name
SNW1
UniProt Synonym Gene Names
SKIIP; SKIP
UniProt Entry Name
SNW1_HUMAN

Similar Products

Product Notes

The SNW1 snw1 (Catalog #AAA197322) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SKIIP antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's SKIIP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SNW1 snw1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RQGQSKDKVI YSKYTDLVPK EVMNADDPDL QRPDEEAIKE ITEKTRVALE. It is sometimes possible for the material contained within the vial of "SKIIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.