Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46231_IHC10.jpg IHC (Immunohistochemistry) (Anti- SLC12A1 Picoband antibody, AAA46231, IHC(P)IHC(P): Human Kidney Cancer Tissue)

SLC12A1 Polyclonal Antibody | anti-SLC12A1 antibody

Anti-SLC12A1 Antibody

Gene Names
SLC12A1; BSC1; NKCC2
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SLC12A1, Antibody; Anti-SLC12A1 Antibody; Solute carrier family 12 member 1; BSC1; Bumetanide sensitive sodium 3; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2; Kidney specific Na K Cl symporter; Kidney-specific Na-K-Cl symporter; MGC48843; Na K 2Cl cotransporter; NKCC2; potassiumchloride cotransporter 2; S12A1_HUMAN; Slc12a1; sodium potassium chloride cotransporter 2; solute carrier family 12 (sodium/potassium/chloride transporters); Solute carrier family 12 member 1 antibody; solute carrier family 12 (sodium/potassium/chloride transporters), member 1; anti-SLC12A1 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1099
Applicable Applications for anti-SLC12A1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- SLC12A1 Picoband antibody, AAA46231, IHC(P)IHC(P): Human Kidney Cancer Tissue)

product-image-AAA46231_IHC10.jpg IHC (Immunohistochemistry) (Anti- SLC12A1 Picoband antibody, AAA46231, IHC(P)IHC(P): Human Kidney Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- SLC12A1 Picoband antibody, AAA46231, IHC(P)IHC(P): Rat Kidney Tissue)

product-image-AAA46231_IHC11.jpg IHC (Immunohistochemisry) (Anti- SLC12A1 Picoband antibody, AAA46231, IHC(P)IHC(P): Rat Kidney Tissue)

IHC (Immunohiostchemistry)

(Anti- SLC12A1 Picoband antibody, AAA46231, IHC(P)IHC(P): Mouse Kidney Tissue)

product-image-AAA46231_IHC13.jpg IHC (Immunohiostchemistry) (Anti- SLC12A1 Picoband antibody, AAA46231, IHC(P)IHC(P): Mouse Kidney Tissue)

WB (Western Blot)

(Anti- SLC12A1 Picoband antibody, AAA46231, Western blottingAll lanes: Anti SLC12A1 (AAA46231) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: JURKAT Whole Cell Lysate at 40ugLane 3: SKOV Whole Cell Lysate at 40ugLane 4: Mouse Kidney Tissue Lysate at 50ugPredicted bind size: 121KDObserved bind size: 121KD)

product-image-AAA46231_WB15.jpg WB (Western Blot) (Anti- SLC12A1 Picoband antibody, AAA46231, Western blottingAll lanes: Anti SLC12A1 (AAA46231) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: JURKAT Whole Cell Lysate at 40ugLane 3: SKOV Whole Cell Lysate at 40ugLane 4: Mouse Kidney Tissue Lysate at 50ugPredicted bind size: 121KDObserved bind size: 121KD)
Related Product Information for anti-SLC12A1 antibody
Description: Rabbit IgG polyclonal antibody for Solute carrier family 12 member 1(SLC12A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume.
References
1. Nozu, K., Iijima, K., Kawai, K., Nozu, Y., Nishida, A., Takeshima, Y., Fu, X. J., Hashimura, Y., Kaito, H., Nakanishi, K., Yoshikawa, N., Matsuo, M. In vivo and in vitro splicing assay of SLC12A1 in an antenatal salt-losing tubulopathy patient with an intronic mutation. Hum. Genet. 126: 533-538, 2009. 2. Takahashi, N., Chernavvsky, D. R., Gomez, R. A., Igarashi, P., Gitelman, H. J., Smithies, O.Uncompensated polyuria in a mouse model of Bartter's syndrome. Proc. Nat. Acad. Sci. 97: 5434-5439, 2000.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
– Da
NCBI Official Full Name
solute carrier family 12 member 1 isoform A
NCBI Official Synonym Full Names
solute carrier family 12 member 1
NCBI Official Symbol
SLC12A1
NCBI Official Synonym Symbols
BSC1; NKCC2
NCBI Protein Information
solute carrier family 12 member 1
UniProt Protein Name
Solute carrier family 12 member 1
UniProt Gene Name
SLC12A1
UniProt Synonym Gene Names
NKCC2
UniProt Entry Name
S12A1_HUMAN

Similar Products

Product Notes

The SLC12A1 slc12a1 (Catalog #AAA46231) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SLC12A1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC12A1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SLC12A1 slc12a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC12A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.