Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199362_WB13.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.)

Rabbit SLC15A2 Polyclonal Antibody | anti-SLC15A2 antibody

SLC15A2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
SLC15A2; PEPT2
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC15A2, Antibody; SLC15A2 antibody - middle region; anti-SLC15A2 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV
Sequence Length
729
Applicable Applications for anti-SLC15A2 antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 83%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 93%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC15A2
Protein Size (# AA)
729 amino acids
Protein Interactions
PDZD3; PDZK1;
Blocking Peptide
For anti-SLC15A2 antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.)

product-image-AAA199362_WB13.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.)

WB (Western Blot)

(WB Suggested Anti-SLC15A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateSLC15A2 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA199362_WB15.jpg WB (Western Blot) (WB Suggested Anti-SLC15A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateSLC15A2 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-SLC15A2 antibody
This is a rabbit polyclonal antibody against SLC15A2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SLC15A2 belongs to the PTR2/POT transporter (TC 2.A.17) family. It is a multi-pass membrane protein. The expression/activity of PEPT2 (SLC15A2) may be a critical factor in the modulation of opioidergic neurotransmission in vivo.
Product Categories/Family for anti-SLC15A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
solute carrier family 15 member 2 isoform a
NCBI Official Synonym Full Names
solute carrier family 15 member 2
NCBI Official Symbol
SLC15A2
NCBI Official Synonym Symbols
PEPT2
NCBI Protein Information
solute carrier family 15 member 2
UniProt Protein Name
Solute carrier family 15 member 2
UniProt Gene Name
SLC15A2
UniProt Synonym Gene Names
PEPT2
UniProt Entry Name
S15A2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SLC15A2 slc15a2 (Catalog #AAA199362) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC15A2 antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SLC15A2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLC15A2 slc15a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNENNSLLIE SIKSFQKTPH YSKLHLKTKS QDFHFHLKYH NLSLYTEHSV. It is sometimes possible for the material contained within the vial of "SLC15A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.