Rabbit SLC25A39 Polyclonal Antibody | anti-SLC25A39 antibody
SLC25A39 antibody
Gene Names
SLC25A39; CGI69; CGI-69
Reactivity
Cow, dog, guinea pig, horse, human, mouse, rabbit rat, zebrafish.
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
SLC25A39, Antibody; SLC25A39 antibody; Polyclonal SLC25A39; Anti-SLC25A39; Solute Carrier Family 25 Member 39; CGI69; SLCA39-25; SLC25A39; SLCA39 25; CGI-69; FLJ22407; anti-SLC25A39 antibody
Host
Rabbit
Reactivity
Cow, dog, guinea pig, horse, human, mouse, rabbit rat, zebrafish.
Clonality
Polyclonal
Specificity
SLC25A39 antibody was raised against the C terminal of SLC25A39
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A39 antibody in PBS
Concentration
50ug, lyophilized (varies by lot)
Sequence Length
359
Applicable Applications for anti-SLC25A39 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.
Immunogen
Synthetic peptide directed toward the C terminal region of human SLC25A39.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
SLC25A39 antibody was raised using the C terminal of SLC25A39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF
Assay Information
SLC25A39 Blocking Peptide, catalog no.(Please Inquire).
Preparation and Storage
Ships ambient or refrigerated. Upon receipt store at 4 degree C shor term, -20 degree C long term. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-SLC25A39 antibody
Rabbit polyclonal SLC25A39 antibody raised against the C terminal of SLC25A39
Product Categories/Family for anti-SLC25A39 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
39 kDa (MW of target protein)
NCBI Official Full Name
SLC25A39 protein
NCBI Official Synonym Full Names
solute carrier family 25, member 39
NCBI Official Symbol
SLC25A39
NCBI Official Synonym Symbols
CGI69; CGI-69
NCBI Protein Information
solute carrier family 25 member 39
UniProt Protein Name
Solute carrier family 25 member 39
UniProt Gene Name
SLC25A39
UniProt Entry Name
S2539_HUMAN
Similar Products
Product Notes
The SLC25A39 slc25a39 (Catalog #AAA224357) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A39 antibody reacts with Cow, dog, guinea pig, horse, human, mouse, rabbit rat, zebrafish. and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A39 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SLC25A39 slc25a39 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC25A39, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
