Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199045_AD11.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

Rabbit SLC2A5 Polyclonal Antibody | anti-SLC2A5 antibody

SLC2A5 Antibody

Gene Names
SLC2A5; GLUT5; GLUT-5
Reactivity
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep (Tested Reactivity: Human Mouse)
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
SLC2A5, Antibody; SLC2A5 Antibody; anti-SLC2A5 antibody
Ordering
Host
Rabbit
Reactivity
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep (Tested Reactivity: Human Mouse)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: ADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGF
Sequence Length
501
Applicable Applications for anti-SLC2A5 antibody
WB (Western Blot), IF (Immunofluorescence)
Protein Size
501 amino acids
Protein Interactions
CCL5; RPSA
Replacement Item
This antibody may replace item sc-14841 from Santa Cruz Biotechnology.
Homology
Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC2A5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Application Data

(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

product-image-AAA199045_AD11.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

WB (Western Blot)

(WB Suggested Anti-SLC2A5 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA199045_WB13.jpg WB (Western Blot) (WB Suggested Anti-SLC2A5 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

IF (Immunofluorescence)

(Sample Type: Mouse HEI-OCIAuditory HEI-OCI)

product-image-AAA199045_IF15.jpg IF (Immunofluorescence) (Sample Type: Mouse HEI-OCIAuditory HEI-OCI)
Related Product Information for anti-SLC2A5 antibody
This is a rabbit polyclonal antibody against SLC2A5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SLC2A5 is a cytochalasin B-sensitive carrier. It seems to function primarily as a fructose transporter.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
solute carrier family 2, facilitated glucose transporter member 5 isoform 1
NCBI Official Synonym Full Names
solute carrier family 2 member 5
NCBI Official Symbol
SLC2A5
NCBI Official Synonym Symbols
GLUT5; GLUT-5
NCBI Protein Information
solute carrier family 2, facilitated glucose transporter member 5
UniProt Protein Name
Solute carrier family 2, facilitated glucose transporter member 5
UniProt Gene Name
SLC2A5
UniProt Synonym Gene Names
GLUT5; GLUT-5
UniProt Entry Name
GTR5_HUMAN

Similar Products

Product Notes

The SLC2A5 slc2a5 (Catalog #AAA199045) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC2A5 Antibody reacts with Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep (Tested Reactivity: Human Mouse) and may cross-react with other species as described in the data sheet. AAA Biotech's SLC2A5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the SLC2A5 slc2a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ADQIYLSAGV PEEHVQYVTA GTGAVNVVMT FCAVFVVELL GRRLLLLLGF. It is sometimes possible for the material contained within the vial of "SLC2A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.