Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224399_IHC13.jpg IHC (Immunohiostchemistry) (Skeletal muscle)

Rabbit SLC36A2 Polyclonal Antibody | anti-SLC36A2 antibody

SLC36A2 antibody

Gene Names
SLC36A2; PAT2; TRAMD1
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC36A2, Antibody; SLC36A2 antibody; Polyclonal SLC36A2; Anti-SLC36A2; Solute Carrier Family 36 Member 2; SLCA2-36; PAT2; MGC119660; TRAMD1; FLJ16051; Proton/Amino Acid Symporter 2; MGC119658; SLCA2 36; SLC36A2; anti-SLC36A2 antibody
Ordering
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC36A2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
285
Applicable Applications for anti-SLC36A2 antibody
WB (Western Blot)
Biological Significance
SLC36A2 is involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids amino acids such as glycine, alanine and proline. SLC36A2 is inhibited by sarcosine.
Cross-Reactivity
Human
Immunogen
SLC36A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohiostchemistry)

(Skeletal muscle)

product-image-AAA224399_IHC13.jpg IHC (Immunohiostchemistry) (Skeletal muscle)

WB (Western Blot)

(Recommended SLC36A2 Antibody Titration: 0.2-1 ug/ml)

product-image-AAA224399_WB15.jpg WB (Western Blot) (Recommended SLC36A2 Antibody Titration: 0.2-1 ug/ml)
Related Product Information for anti-SLC36A2 antibody
Rabbit polyclonal SLC36A2 antibody
Product Categories/Family for anti-SLC36A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
53 kDa (MW of target protein)
NCBI Official Full Name
SLC36A2 protein
NCBI Official Synonym Full Names
solute carrier family 36 (proton/amino acid symporter), member 2
NCBI Official Symbol
SLC36A2
NCBI Official Synonym Symbols
PAT2; TRAMD1
NCBI Protein Information
proton-coupled amino acid transporter 2
UniProt Protein Name
Proton-coupled amino acid transporter 2
UniProt Gene Name
SLC36A2
UniProt Synonym Gene Names
PAT2; TRAMD1; Proton/amino acid transporter 2
UniProt Entry Name
S36A2_HUMAN

Similar Products

Product Notes

The SLC36A2 slc36a2 (Catalog #AAA224399) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC36A2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLC36A2 slc36a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC36A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.