WB (Western Blot)
(Host: RabbitTarget: SLC7A11Positive control (+): HeLa Cell Lysate (HL)Negative control (-): MCF7 Cell Lysate (N10)Antibody concentration: 3ug/ml)
Rabbit SLC7A11 Polyclonal Antibody | anti-SLC7A11 antibody
SLC7A11 antibody - middle region
Gene Names
SLC7A11; xCT; CCBR1
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC7A11, Antibody; SLC7A11 antibody - middle region; anti-SLC7A11 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK
Sequence Length
501
Applicable Applications for anti-SLC7A11 antibody
WB (Western Blot)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC7A11
Protein Size (#AA)
501 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget: SLC7A11Positive control (+): HeLa Cell Lysate (HL)Negative control (-): MCF7 Cell Lysate (N10)Antibody concentration: 3ug/ml)
WB (Western Blot)
(Host: RabbitTarget: SLC7A11Positive control (+): HeLa Cell Lysate (HL)Negative control (-): MCF7 Cell Lysate (N10)Antibody concentration: 3ug/ml)
WB (Western Blot)
(WB Suggested Anti-SLC7A11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)
WB (Western Blot)
(WB Suggested Anti-SLC7A11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)
Related Product Information for anti-SLC7A11 antibody
This is a rabbit polyclonal antibody against SLC7A11. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate.
Target Description: SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate.
Product Categories/Family for anti-SLC7A11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
cystine/glutamate transporter
NCBI Official Synonym Full Names
solute carrier family 7 member 11
NCBI Official Symbol
SLC7A11
NCBI Official Synonym Symbols
xCT; CCBR1
NCBI Protein Information
cystine/glutamate transporter
UniProt Protein Name
Cystine/glutamate transporter
UniProt Gene Name
SLC7A11
UniProt Entry Name
XCT_HUMAN
Similar Products
Product Notes
The SLC7A11 slc7a11 (Catalog #AAA199351) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC7A11 antibody - middle region reacts with Tested Species Reactivity: HumanPredicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC7A11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLC7A11 slc7a11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KGQTQNFKDA FSGRDSSITR LPLAFYYGMY AYAGWFYLNF VTEEVENPEK. It is sometimes possible for the material contained within the vial of "SLC7A11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.
Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.