Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201226_WB10.jpg WB (Western Blot) (WB Suggested Anti-SLC7A5 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit anti-Human SLC7A5 Polyclonal Antibody | anti-SLC7A5 antibody

SLC7A5 antibody - N-terminal region

Gene Names
SLC7A5; E16; CD98; LAT1; 4F2LC; MPE16; D16S469E
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC7A5, Antibody; SLC7A5 antibody - N-terminal region; anti-SLC7A5 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
Sequence Length
507
Applicable Applications for anti-SLC7A5 antibody
WB (Western Blot)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SLC7A5 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

product-image-AAA201226_WB10.jpg WB (Western Blot) (WB Suggested Anti-SLC7A5 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: SLC7A5Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlSLC7A5 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA201226_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SLC7A5Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlSLC7A5 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: SLC7A5Sample Type: Human HelaAntibody Dilution: 1.0ug/mlSLC7A5 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA201226_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SLC7A5Sample Type: Human HelaAntibody Dilution: 1.0ug/mlSLC7A5 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: SLC7A5Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlSLC7A5 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA201226_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SLC7A5Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlSLC7A5 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-SLC7A5 antibody
This is a rabbit polyclonal antibody against SLC7A5. It was validated on Western Blot

Target Description: SLC7A5 is a sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. SLC7A5 is involved in cellular amino acid uptake. SLC7A5 acts as an amino acid exchanger. SLC7A5 is involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. SLC7A5 plays a role in neuronal cell proliferation (neurogenesis) in brain. SLC7A5 is involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. SLC7A5 is involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. SLC7A5 may play an important role in high-grade gliomas. SLC7A5 mediates blood-to-retina L-leucine transport across the inner blood-retinal barrier which in turn may play a key role in maintaining large neutral amino acids as well as neurotransmitters in the neural retina. SLC7A5 acts as the major transporter of tyrosine in fibroblasts.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
large neutral amino acids transporter small subunit 1
NCBI Official Synonym Full Names
solute carrier family 7 member 5
NCBI Official Symbol
SLC7A5
NCBI Official Synonym Symbols
E16; CD98; LAT1; 4F2LC; MPE16; D16S469E
NCBI Protein Information
large neutral amino acids transporter small subunit 1
UniProt Protein Name
Large neutral amino acids transporter small subunit 1
UniProt Gene Name
SLC7A5
UniProt Synonym Gene Names
CD98LC; LAT1; MPE16; 4F2 LC; 4F2LC; hLAT1
UniProt Entry Name
LAT1_HUMAN

Similar Products

Product Notes

The SLC7A5 slc7a5 (Catalog #AAA201226) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC7A5 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC7A5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLC7A5 slc7a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAGAGPKRRA LAAPAAEEKE EAREKMLAAK SADGSAPAGE GEGVTLQRNI. It is sometimes possible for the material contained within the vial of "SLC7A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.