<
WB (Western Blot)
(WB Suggested Anti-SMN1 AntibodyTitration: 0.2-1 ug/mlPositive Control: HepG2)
Rabbit SMN1 Polyclonal Antibody | anti-SMN1 antibody
SMN1 antibody - N-terminal region
Gene Names
SMN1; SMA; SMN; SMA1; SMA2; SMA3; SMA4; SMA@; SMNT; BCD541; GEMIN1; TDRD16A; T-BCD541
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SMN1, Antibody; SMN1 antibody - N-terminal region; anti-SMN1 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV
Sequence Length
262
Applicable Applications for anti-SMN1 antibody
WB (Western Blot)
Homology
Dog: 100%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 85%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SMN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SMN1 AntibodyTitration: 0.2-1 ug/mlPositive Control: HepG2)
WB (Western Blot)
(WB Suggested Anti-SMN1 AntibodyTitration: 0.2-1 ug/mlPositive Control: HepG2)
WB (Western Blot)
(Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlSMN1 is supported by BioGPS gene expression data to be expressed in MCF7)
WB (Western Blot)
(Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlSMN1 is supported by BioGPS gene expression data to be expressed in MCF7)
WB (Western Blot)
(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: SMN1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: SMN1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-SMN1 antibody
This is a rabbit polyclonal antibody against SMN1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SMN1 localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein.This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. However, mutations in this gene, the telomeric copy, are associated with spinal muscular atrophy; mutations in the centromeric copy do not lead to disease. The centromeric copy may be a modifier of disease caused by mutation in the telomeric copy. The critical sequence difference between the two genes is a single nucleotide in exon 7 which is thought to be an exon splice enhancer. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The protein encoded by this gene localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Two transcript variants are produced by this gene.
Target Description: SMN1 localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein.This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. However, mutations in this gene, the telomeric copy, are associated with spinal muscular atrophy; mutations in the centromeric copy do not lead to disease. The centromeric copy may be a modifier of disease caused by mutation in the telomeric copy. The critical sequence difference between the two genes is a single nucleotide in exon 7 which is thought to be an exon splice enhancer. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The protein encoded by this gene localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Two transcript variants are produced by this gene.
Product Categories/Family for anti-SMN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
survival motor neuron protein isoform a
NCBI Official Synonym Full Names
survival of motor neuron 1, telomeric
NCBI Official Symbol
SMN1
NCBI Official Synonym Symbols
SMA; SMN; SMA1; SMA2; SMA3; SMA4; SMA@; SMNT; BCD541; GEMIN1; TDRD16A; T-BCD541
NCBI Protein Information
survival motor neuron protein
UniProt Protein Name
Survival motor neuron protein
UniProt Gene Name
SMN1
UniProt Synonym Gene Names
SMN; SMNT
UniProt Entry Name
SMN_HUMAN
Similar Products
Product Notes
The SMN1 smn1 (Catalog #AAA198588) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMN1 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SMN1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SMN1 smn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAVASFKHAL KNGDICETSG KPKTTPKRKP AKKNKSQKKN TAASLQQWKV. It is sometimes possible for the material contained within the vial of "SMN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.