Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23422_WB6.jpg WB (Western Blot) (WB Suggested Anti-SNAI1 Antibody Titration: 1ug/mlPositive Control: 721_B cell lysateSNAI1 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit SNAI1 Polyclonal Antibody | anti-SNAI1 antibody

SNAI1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SNAI1; SNA; SNAH; SNAIL; SLUGH2; SNAIL1; dJ710H13.1
Reactivity
Guinea Pig, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SNAI1, Antibody; SNAI1 antibody - N-terminal region; anti-SNAI1 antibody
Ordering
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL
Sequence Length
264
Applicable Applications for anti-SNAI1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SNAI1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SNAI1 Antibody Titration: 1ug/mlPositive Control: 721_B cell lysateSNAI1 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA23422_WB6.jpg WB (Western Blot) (WB Suggested Anti-SNAI1 Antibody Titration: 1ug/mlPositive Control: 721_B cell lysateSNAI1 is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(WB Suggested Anti-SNAI1 antibody Titration: 1 ug/mLSample Type: Human A549)

product-image-AAA23422_WB5.jpg WB (Western Blot) (WB Suggested Anti-SNAI1 antibody Titration: 1 ug/mLSample Type: Human A549)

WB (Western Blot)

(WB Suggested Anti-SNAI1 antibody Titration: 1 ug/mLSample Type: Human 721_B)

product-image-AAA23422_WB4.jpg WB (Western Blot) (WB Suggested Anti-SNAI1 antibody Titration: 1 ug/mLSample Type: Human 721_B)

WB (Western Blot)

(Host: MouseTarget Name: SNAI1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

product-image-AAA23422_WB3.jpg WB (Western Blot) (Host: MouseTarget Name: SNAI1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-SNAI1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA23422_IHC2.jpg IHC (Immunohistochemistry) (Rabbit Anti-SNAI1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA23422_IHC.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-SNAI1 antibody
This is a rabbit polyclonal antibody against SNAI1. It was validated on Western Blot and immunohistochemistry

Target Description: The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
zinc finger protein SNAI1
NCBI Official Synonym Full Names
snail family transcriptional repressor 1
NCBI Official Symbol
SNAI1
NCBI Official Synonym Symbols
SNA; SNAH; SNAIL; SLUGH2; SNAIL1; dJ710H13.1
NCBI Protein Information
zinc finger protein SNAI1
UniProt Protein Name
Zinc finger protein SNAI1
UniProt Gene Name
SNAI1
UniProt Synonym Gene Names
SNAH; Protein sna
UniProt Entry Name
SNAI1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SNAI1 snai1 (Catalog #AAA23422) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNAI1 antibody - N-terminal region reacts with Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SNAI1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SNAI1 snai1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPRSFLVRKP SDPNRKPNYS ELQDSNPEFT FQQPYDQAHL LAAIPPPEIL. It is sometimes possible for the material contained within the vial of "SNAI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.