Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281029_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human stomach using SNAI2 Antibody at dilution of 1:100 (40x lens).)

Rabbit SNAI2 Polyclonal Antibody | anti-SNAI2 antibody

SNAI2 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
SNAI2; SLUG; WS2D; SLUGH; SLUGH1; SNAIL2
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
SNAI2, Antibody; SNAI2 Polyclonal Antibody; SLUG; SLUGH; SLUGH1; SNAIL2; WS2D; anti-SNAI2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
EKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH
Sequence Length
268
Applicable Applications for anti-SNAI2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human SNAI2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human stomach using SNAI2 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA281029_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human stomach using SNAI2 Antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human breast cancer using SNAI2 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA281029_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human breast cancer using SNAI2 Antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human liver injury using SNAI2 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA281029_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human liver injury using SNAI2 Antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-SNAI2 antibody
This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.
Product Categories/Family for anti-SNAI2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
zinc finger protein SNAI2
NCBI Official Synonym Full Names
snail family transcriptional repressor 2
NCBI Official Symbol
SNAI2
NCBI Official Synonym Symbols
SLUG; WS2D; SLUGH; SLUGH1; SNAIL2
NCBI Protein Information
zinc finger protein SNAI2
UniProt Protein Name
Zinc finger protein SNAI2
UniProt Gene Name
SNAI2
UniProt Synonym Gene Names
SLUG; SLUGH

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SNAI2 snai2 (Catalog #AAA281029) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNAI2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SNAI2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SNAI2 snai2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EKFQCNLCNK TYSTFSGLAK HKQLHCDAQS RKSFSCKYCD KEYVSLGALK MHIRTHTLPC VCKICGKAFS RPWLLQGHIR THTGEKPFSC PHCNRAFADR SNLRAHLQTH SDVKKYQCKN CSKTFSRMSL LHKHEESGCC VAH. It is sometimes possible for the material contained within the vial of "SNAI2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.