Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199102_WB13.jpg WB (Western Blot) (WB Suggested Anti-SNCA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit SNCA Polyclonal Antibody | anti-SNCA antibody

SNCA antibody - middle region

Gene Names
SNCA; PD1; NACP; PARK1; PARK4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SNCA, Antibody; SNCA antibody - middle region; anti-SNCA antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA
Sequence Length
112
Applicable Applications for anti-SNCA antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SNCA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SNCA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

product-image-AAA199102_WB13.jpg WB (Western Blot) (WB Suggested Anti-SNCA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA199102_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SNCA antibody
This is a rabbit polyclonal antibody against SNCA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
alpha-synuclein isoform NACP112
NCBI Official Synonym Full Names
synuclein alpha
NCBI Official Symbol
SNCA
NCBI Official Synonym Symbols
PD1; NACP; PARK1; PARK4
NCBI Protein Information
alpha-synuclein
UniProt Protein Name
Alpha-synuclein
UniProt Gene Name
SNCA
UniProt Synonym Gene Names
NACP; PARK1; NACP
UniProt Entry Name
SYUA_HUMAN

Similar Products

Product Notes

The SNCA snca (Catalog #AAA199102) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNCA antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SNCA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SNCA snca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTNVGGAVVT GVTAVAQKTV EGAGSIAAAT GFVKKDQLGK EGYQDYEPEA. It is sometimes possible for the material contained within the vial of "SNCA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.