Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197478_WB13.jpg WB (Western Blot) (WB Suggested Anti-Snf8 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)

Rabbit Snf8 Polyclonal Antibody | anti-SNF8 antibody

Snf8 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Snf8; D11moh34; RGD1310144
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Snf8, Antibody; Snf8 antibody - N-terminal region; anti-SNF8 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCAT
Sequence Length
258
Applicable Applications for anti-SNF8 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Snf8 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)

product-image-AAA197478_WB13.jpg WB (Western Blot) (WB Suggested Anti-Snf8 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)

IHC (Immunohistochemistry)

(Rabbit Anti-Snf8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA197478_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-Snf8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-SNF8 antibody
This is a rabbit polyclonal antibody against Snf8. It was validated on Western Blot

Target Description: Snf8 is required for degradation of both endocytosed EGF and EGFR, but not for the EGFR ligand-mediated internalization. It is a component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation by participating in derepression of transcription by RNA polymerase II, possibly via its interaction with ELL.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
vacuolar-sorting protein SNF8
NCBI Official Synonym Full Names
SNF8, ESCRT-II complex subunit
NCBI Official Symbol
Snf8
NCBI Official Synonym Symbols
D11moh34; RGD1310144
NCBI Protein Information
vacuolar-sorting protein SNF8
UniProt Protein Name
Vacuolar-sorting protein SNF8
UniProt Gene Name
Snf8
UniProt Synonym Gene Names
Eap30
UniProt Entry Name
SNF8_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SNF8 snf8 (Catalog #AAA197478) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Snf8 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Snf8 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SNF8 snf8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTVLAEDQLA QMSKQLDMFK TNLEEFASKH KQEIRKNPEF RVQFQDMCAT. It is sometimes possible for the material contained within the vial of "Snf8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.