<
WB (Western Blot)
(WB Suggested Anti-SNRNP200 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Rabbit SNRNP200 Polyclonal Antibody | anti-SNRNP200 antibody
SNRNP200 antibody - N-terminal region
Gene Names
SNRNP200; BRR2; RP33; HELIC2; ASCC3L1; U5-200KD
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SNRNP200, Antibody; SNRNP200 antibody - N-terminal region; anti-SNRNP200 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPR
Sequence Length
2136
Applicable Applications for anti-SNRNP200 antibody
WB (Western Blot)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SNRNP200 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
WB (Western Blot)
(WB Suggested Anti-SNRNP200 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
WB (Western Blot)
(Host: RabbitTarget Name: SNRNP200Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: SNRNP200Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: SNRNP200Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: SNRNP200Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: SNRNP200Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: SNRNP200Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-SNRNP200 antibody
This is a rabbit polyclonal antibody against SNRNP200. It was validated on Western Blot
Target Description: Pre-mRNA splicing is catalyzed by the spliceosome, a complex of specialized RNA and protein subunits that removes introns from a transcribed pre-mRNA segment. The spliceosome consists of small nuclear RNA proteins (snRNPs) U1, U2, U4, U5 and U6, together with approximately 80 conserved proteins. U5 snRNP contains nine specific proteins. This gene encodes one of the U5 snRNP-specific proteins. This protein belongs to the DEXH-box family of putative RNA helicases. It is a core component of U4/U6-U5 snRNPs and appears to catalyze an ATP-dependent unwinding of U4/U6 RNA duplices. Mutations in this gene cause autosomal-dominant retinitis pigmentosa.
Target Description: Pre-mRNA splicing is catalyzed by the spliceosome, a complex of specialized RNA and protein subunits that removes introns from a transcribed pre-mRNA segment. The spliceosome consists of small nuclear RNA proteins (snRNPs) U1, U2, U4, U5 and U6, together with approximately 80 conserved proteins. U5 snRNP contains nine specific proteins. This gene encodes one of the U5 snRNP-specific proteins. This protein belongs to the DEXH-box family of putative RNA helicases. It is a core component of U4/U6-U5 snRNPs and appears to catalyze an ATP-dependent unwinding of U4/U6 RNA duplices. Mutations in this gene cause autosomal-dominant retinitis pigmentosa.
Product Categories/Family for anti-SNRNP200 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
244kDa
NCBI Official Full Name
U5 small nuclear ribonucleoprotein 200 kDa helicase
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein U5 subunit 200
NCBI Official Symbol
SNRNP200
NCBI Official Synonym Symbols
BRR2; RP33; HELIC2; ASCC3L1; U5-200KD
NCBI Protein Information
U5 small nuclear ribonucleoprotein 200 kDa helicase
UniProt Protein Name
U5 small nuclear ribonucleoprotein 200 kDa helicase
UniProt Gene Name
SNRNP200
UniProt Synonym Gene Names
ASCC3L1; HELIC2; KIAA0788; U5-200KD
UniProt Entry Name
U520_HUMAN
Similar Products
Product Notes
The SNRNP200 snrnp200 (Catalog #AAA198074) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNRNP200 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SNRNP200 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SNRNP200 snrnp200 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GDEDVYGEVR EEASDDDMEG DEAVVRCTLS ANLVASGELM SSKKKDLHPR. It is sometimes possible for the material contained within the vial of "SNRNP200, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.