Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23583_WB7.jpg WB (Western Blot) (WB Suggested Anti-SOD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

Rabbit SOD2 Polyclonal Antibody | anti-SOD2 antibody

SOD2 antibody - N-terminal region

Gene Names
SOD2; IPOB; IPO-B; MNSOD; MVCD6; Mn-SOD
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SOD2, Antibody; SOD2 antibody - N-terminal region; anti-SOD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH
Sequence Length
222
Applicable Applications for anti-SOD2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SOD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SOD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

product-image-AAA23583_WB7.jpg WB (Western Blot) (WB Suggested Anti-SOD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

WB (Western Blot)

(WB Suggested Anti-SOD2 antibodyTitration: 0.4 ug/mlPositive Control: Rat dorsal medulla brain & cortax + hypothalamus extract)

product-image-AAA23583_WB6.jpg WB (Western Blot) (WB Suggested Anti-SOD2 antibodyTitration: 0.4 ug/mlPositive Control: Rat dorsal medulla brain & cortax + hypothalamus extract)

WB (Western Blot)

(Lanes:1. 40ug rat dorsal medulla brain extract 2. 20 ug rat cortax + hypothalamus mitochondria extractPrimary Antibody Dilution:1:2500Secondary Antibody:Anti-Rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:SOD2Submitted by:Manisha Nautiyal, Hypertension and Vascular Research Center, Wake Forest University School of Medicine)

product-image-AAA23583_WB5.jpg WB (Western Blot) (Lanes:1. 40ug rat dorsal medulla brain extract 2. 20 ug rat cortax + hypothalamus mitochondria extractPrimary Antibody Dilution:1:2500Secondary Antibody:Anti-Rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:SOD2Submitted by:Manisha Nautiyal, Hypertension and Vascular Research Center, Wake Forest University School of Medicine)

WB (Western Blot)

(Lanes:1. 40 ug HK2 cell (kidney proximal tubular cell line) 2. 40 ug H2O2 treated human HK2 Cell lysate3. 40 ug H2O2 treated human HK2 Cell lysate4. 40 ug H2O2 treated human HK2 Cell lysate5. 40 ug H2O2 treated human HK2 Cell lysate6. 40 ug H2O2 treated human HK2 Cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-Rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:SOD2Submitted by:The University of Queensland, School of Medicine, Centre for Kidney Disease Research)

product-image-AAA23583_WB4.jpg WB (Western Blot) (Lanes:1. 40 ug HK2 cell (kidney proximal tubular cell line) 2. 40 ug H2O2 treated human HK2 Cell lysate3. 40 ug H2O2 treated human HK2 Cell lysate4. 40 ug H2O2 treated human HK2 Cell lysate5. 40 ug H2O2 treated human HK2 Cell lysate6. 40 ug H2O2 treated human HK2 Cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-Rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:SOD2Submitted by:The University of Queensland, School of Medicine, Centre for Kidney Disease Research)

WB (Western Blot)

(Host: RabbitTarget Name: SOD2Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23583_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: SOD2Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA23583_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA23583_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: NOP56Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SOD2 antibody
This is a rabbit polyclonal antibody against SOD2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SOD2 is a member of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene encoding SOD2 have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer.This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
superoxide dismutase
NCBI Official Synonym Full Names
superoxide dismutase 2
NCBI Official Symbol
SOD2
NCBI Official Synonym Symbols
IPOB; IPO-B; MNSOD; MVCD6; Mn-SOD
NCBI Protein Information
superoxide dismutase [Mn], mitochondrial
UniProt Protein Name
Superoxide dismutase [Mn], mitochondrial
UniProt Gene Name
SOD2
UniProt Entry Name
SODM_HUMAN

Similar Products

Product Notes

The SOD2 sod2 (Catalog #AAA23583) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOD2 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SOD2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SOD2 sod2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLSRAVCGTS RQLAPVLGYL GSRQKHSLPD LPYDYGALEP HINAQIMQLH. It is sometimes possible for the material contained within the vial of "SOD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.