Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA124668_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of SOD3 using anti-SOD3 antibody (AAA124668).SOD3 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SOD3 Antibody (AAA124668) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

Rabbit SOD3/Ec Sod Polyclonal Antibody | anti-SOD3 antibody

Anti-SOD3/Ec Sod Picoband antibody

Gene Names
SOD3; EC-SOD
Reactivity
Human
No cross reactivity with other proteins.
Applications
Immunohistochemistry
Synonyms
SOD3/Ec Sod, Antibody; Anti-SOD3/Ec Sod Picoband antibody; Extracellular superoxide dismutase [Cu-Zn]; EC-SOD; 1.15.1.1; SOD3; anti-SOD3 antibody
Ordering
Host
Rabbit
Reactivity
Human
No cross reactivity with other proteins.
Clonality
Polyclonal
Form/Format
Lyophilized
Sequence Length
240
Applicable Applications for anti-SOD3 antibody
IHC (Immunohistochemistry)
Immunogen
A synthetic peptide corresponding to a sequence of human SOD3 (WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD).
Subcellular Localization
Secreted, extracellular space. 99% of EC-SOD is anchored to heparan sulfate proteoglycans in the tissue interstitium, and 1% is located in the vasculature in equilibrium between the plasma and the endothelium.
Tissue Specificity
Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Figure 2. IHC analysis of SOD3 using anti-SOD3 antibody (AAA124668).SOD3 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SOD3 Antibody (AAA124668) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA124668_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of SOD3 using anti-SOD3 antibody (AAA124668).SOD3 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SOD3 Antibody (AAA124668) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 1. IHC analysis of SOD3 using anti-SOD3 antibody (AAA124668).SOD3 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SOD3 Antibody (AAA124668) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA124668_IHC15.jpg IHC (Immunohistochemistry) (Figure 1. IHC analysis of SOD3 using anti-SOD3 antibody (AAA124668).SOD3 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SOD3 Antibody (AAA124668) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)
Related Product Information for anti-SOD3 antibody
Description: SOD3 (SUPEROXIDE DISMUTASE 3), also called SUPEROXIDE DISMUTASE, EXTRACELLULAR, EC-SOD, and Cu-Zn, is an enzyme that in humans is encoded by the SOD3 gene. This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the dismutation of two superoxide radicals into hydrogen peroxide and oxygen. Hendrickson et al. (1990) mapped the SOD3 gene to 4pter-q21 by a study of somatic cell hybrids. Stern et al. (2003) narrowed the assignment to 4p15.3-p15.1 by somatic cell and radiation hybrid analysis, linkage mapping, and FISH. The product of this gene is thought to protect the brain, lungs, and other tissues from oxidative stress. The protein is secreted into the extracellular space and forms a glycosylated homotetramer that is anchored to the extracellular matrix (ECM) and cell surfaces through an interaction with heparan sulfate proteoglycan and collagen. A fraction of the protein is cleaved near the C-terminus before secretion to generate circulating tetramers that do not interact with the ECM.
Protein Function: Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,851 Da
NCBI Official Full Name
extracellular superoxide dismutase
NCBI Official Synonym Full Names
superoxide dismutase 3
NCBI Official Symbol
SOD3
NCBI Official Synonym Symbols
EC-SOD
NCBI Protein Information
extracellular superoxide dismutase [Cu-Zn]
UniProt Protein Name
Extracellular superoxide dismutase [Cu-Zn]
UniProt Gene Name
SOD3
UniProt Synonym Gene Names
EC-SOD

Similar Products

Product Notes

The SOD3 sod3 (Catalog #AAA124668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-SOD3/Ec Sod Picoband antibody reacts with Human No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's SOD3/Ec Sod can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SOD3 sod3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOD3/Ec Sod, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.