Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23389_WB9.jpg WB (Western Blot) (WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:500Positive Control: OVCAR-3 cell lysateThere is BioGPS gene expression data showing that SOX2 is expressed in OVCAR3)

Rabbit SOX2 Polyclonal Antibody | anti-SOX2 antibody

SOX2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SOX2; ANOP3; MCOPS3
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SOX2, Antibody; SOX2 antibody - N-terminal region; anti-SOX2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV
Sequence Length
317
Applicable Applications for anti-SOX2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SOX2
Protein Size (# AA)
317 amino acids
Protein Interactions
SUMO1; DMAP1; TBX2; SETD7; FAM21A; FZR1; MMS19; MRPS35; ZNF462; LSM2; CCAR2; MIER1; ZDBF2; CHD8; EP400; TSHZ3; RANBP10; ZNF687; XPO5; INTS2; MTA3; CORO1B; CASC5; MRPS22; KCMF1; MEPCE; TRERF1; INTS9; PARVA; SCYL2; CHD7; ZCCHC8; SOX6; BRIX1; SAMD4B; GID8; C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:500Positive Control: OVCAR-3 cell lysateThere is BioGPS gene expression data showing that SOX2 is expressed in OVCAR3)

product-image-AAA23389_WB9.jpg WB (Western Blot) (WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:500Positive Control: OVCAR-3 cell lysateThere is BioGPS gene expression data showing that SOX2 is expressed in OVCAR3)

WB (Western Blot)

(Sample Type: Lane 1: 20 ug U87 lysatePrimary Antibody Dilution: 1:1000Secondary Antibody: Anti-rabbit-HRPSecondary Antibody Dilution: 1:2000Submitted by: Ander Matheu Fernandez, Biodonostia Institute)

product-image-AAA23389_WB8.jpg WB (Western Blot) (Sample Type: Lane 1: 20 ug U87 lysatePrimary Antibody Dilution: 1:1000Secondary Antibody: Anti-rabbit-HRPSecondary Antibody Dilution: 1:2000Submitted by: Ander Matheu Fernandez, Biodonostia Institute)

WB (Western Blot)

(Host: RabbitTarget Name: SOX2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA23389_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: SOX2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SOX2Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA23389_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: SOX2Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: SOX2Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

product-image-AAA23389_WB5.jpg WB (Western Blot) (Host: MouseTarget Name: SOX2Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: SOX2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA23389_WB4.jpg WB (Western Blot) (Host: MouseTarget Name: SOX2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Researcher:Kim Perry, University of IllinoisApplication:IHCSpecies+tissue/cell type:Xenopus laevis cornea epithelliumPrimary antibody dilution:1:300Secondary antibody:Goat anti-rabbit -rhodamineSecondary antibody dilution:1:300)

product-image-AAA23389_IHC3.jpg IHC (Immunohistochemistry) (Researcher:Kim Perry, University of IllinoisApplication:IHCSpecies+tissue/cell type:Xenopus laevis cornea epithelliumPrimary antibody dilution:1:300Secondary antibody:Goat anti-rabbit -rhodamineSecondary antibody dilution:1:300)

IHC (Immunohistochemistry)

(Human Spleen)

product-image-AAA23389_IHC2.jpg IHC (Immunohistochemistry) (Human Spleen)

IHC (Immunohistochemistry)

(Human Kidney)

product-image-AAA23389_IHC.jpg IHC (Immunohistochemistry) (Human Kidney)
Related Product Information for anti-SOX2 antibody
This is a rabbit polyclonal antibody against SOX2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SOX2 is a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The protein may act as a transcriptional activator after forming a protein complex with other proteins. Mutations in this gene have been associated with bilateral anophthalmia, a severe form of structural eye malformation. This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
transcription factor SOX-2
NCBI Official Synonym Full Names
SRY-box 2
NCBI Official Symbol
SOX2
NCBI Official Synonym Symbols
ANOP3; MCOPS3
NCBI Protein Information
transcription factor SOX-2
UniProt Protein Name
Transcription factor SOX-2
UniProt Gene Name
SOX2
UniProt Entry Name
SOX2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SOX2 sox2 (Catalog #AAA23389) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOX2 antibody - N-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SOX2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SOX2 sox2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MYNMMETELK PPGPQQTSGG GGGNSTAAAA GGNQKNSPDR VKRPMNAFMV. It is sometimes possible for the material contained within the vial of "SOX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Frequently Asked Questions


What is Rabbit SOX2 Polyclonal Antibody used for?


The Rabbit SOX2 Polyclonal Antibody is used to detect the SOX2 transcription factor, which is essential for maintaining the pluripotency and self-renewal of embryonic stem cells. It is a vital tool for researchers studying developmental biology, oncology, and the reprogramming of somatic cells into induced pluripotent stem cells (iPSCs).


How does SOX2 antibody detect stem cell markers?


This polyclonal antibody detects SOX2 by binding to multiple epitopes on the target protein, providing a robust signal. Because SOX2 is a nuclear transcription factor, the antibody typically shows strong nuclear staining in IHC and IF applications. Its ability to recognize various regions of the protein makes it highly sensitive for identifying stem cell populations.


Which research applications is this antibody suitable for?


This antibody is suitable for a wide range of applications, including Western Blotting (WB), Immunohistochemistry (IHC), and Immunocytochemistry (ICC/IF). It is frequently used to study neural stem cells, cancer stem cells, and early embryonic development in species such as humans, mice, and rats, helping researchers track cell differentiation and fate.


What are the advantages of using a polyclonal SOX2 antibody?


The primary advantage of using a polyclonal SOX2 antibody from AAA Biotech is its high sensitivity. By targeting multiple epitopes, it can often detect lower levels of protein than monoclonal antibodies. This makes it particularly effective for applications like Western Blotting, where the protein may be denatured or present in low concentrations.


How should Rabbit SOX2 Polyclonal Antibody be stored?


For optimal performance, the Rabbit SOX2 Polyclonal Antibody should be stored at -20°C. It is typically supplied in a buffer containing glycerol to prevent freezing damage. Researchers should avoid frequent temperature fluctuations and freeze-thaw cycles. When stored correctly, the antibody remains stable for approximately 12 months from the date of receipt.


What factors should be considered when selecting a SOX2 antibody?


When selecting a SOX2 antibody, factors like species cross-reactivity and application validation are critical. Ensure the antibody is tested for your target species, such as mouse or human, and your intended method, like IHC-P. Researchers should also evaluate the purity and the need for high sensitivity versus the high specificity offered by monoclonal options.


Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.