Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197477_WB11.jpg WB (Western Blot) (WB Suggested Anti-SP140 Antibody Titration: 5.0ug/mlPositive Control: Raji cell lysateSP140 is supported by BioGPS gene expression data to be expressed in Raji)

Rabbit SP140 Polyclonal Antibody | anti-SP140 antibody

SP140 antibody - N-terminal region

Gene Names
SP140; LYSP100; LYSP100-A; LYSP100-B
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SP140, Antibody; SP140 antibody - N-terminal region; anti-SP140 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
1.0 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: PEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNL
Sequence Length
412
Applicable Applications for anti-SP140 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 86%; Horse: 86%; Human: 100%; Mouse: 77%; Pig: 86%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SP140
Protein Size (# AA)
412 amino acids
Protein Interactions
UBC; Sertad1; SIRT2;
Protein Name
Nuclear body protein SP140
Protein Size (# AA)
412 amino acids
Protein Interactions
UBC; Sertad1; SIRT2;
Blocking Peptide
For anti-SP140 (MBS3201205) antibody is Catalog #
Replacement Item
This antibody may replace item sc-109035 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SP140 Antibody Titration: 5.0ug/mlPositive Control: Raji cell lysateSP140 is supported by BioGPS gene expression data to be expressed in Raji)

product-image-AAA197477_WB11.jpg WB (Western Blot) (WB Suggested Anti-SP140 Antibody Titration: 5.0ug/mlPositive Control: Raji cell lysateSP140 is supported by BioGPS gene expression data to be expressed in Raji)

WB (Western Blot)

(Host: RabbitTarget Name: SP140Sample Type: Human Lung TumorAntibody Dilution: 0.5 ug/ml)

product-image-AAA197477_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SP140Sample Type: Human Lung TumorAntibody Dilution: 0.5 ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-SP 140 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197477_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-SP 140 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-SP140 antibody
This is a rabbit polyclonal antibody against SP140. It was validated on Western Blot and immunohistochemistry

Target Description: SP140 is the nuclear body protein found specifically in all NP cells. HIV-1 infection induced its partial dispersal from nuclear bodies into cytosolic colocalization with Vif.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
nuclear body protein SP140 isoform 2
NCBI Official Synonym Full Names
SP140 nuclear body protein
NCBI Official Symbol
SP140
NCBI Official Synonym Symbols
LYSP100; LYSP100-A; LYSP100-B
NCBI Protein Information
nuclear body protein SP140
UniProt Protein Name
Nuclear body protein SP140
UniProt Gene Name
SP140
UniProt Entry Name
SP140_HUMAN

Similar Products

Product Notes

The SP140 sp140 (Catalog #AAA197477) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SP140 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's SP140 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SP140 sp140 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEPIFRFFRE NKVEIASAIT RPFPFLMGLR DRSFISEQMY EHFQEAFRNL. It is sometimes possible for the material contained within the vial of "SP140, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.