Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46522_IHC13.jpg IHC (Immunohiostchemistry) (Anti- SP5 Picoband antibody, AAA46522, IHC(P)IHC(P): Human Placenta Tissue)

anti-Human Sp5 Polyclonal Antibody | anti-SP5 antibody

Anti-Sp5 Antibody

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Sp5, Antibody; Anti-Sp5 Antibody; Transcription factor Sp5; Sp5 transcription factor; anti-SP5 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
398
Applicable Applications for anti-SP5 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Sp5 (246-275aa DFAQYQSQIAALLQTKAPLAATARRCRRCR), identical to the related mouse sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- SP5 Picoband antibody, AAA46522, IHC(P)IHC(P): Human Placenta Tissue)

product-image-AAA46522_IHC13.jpg IHC (Immunohiostchemistry) (Anti- SP5 Picoband antibody, AAA46522, IHC(P)IHC(P): Human Placenta Tissue)

WB (Western Blot)

(Anti- SP5 Picoband antibody, AAA46522, Western blottingAll lanes: Anti SP5 (AAA46522) at 0.5ug/mlWB: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 42KDObserved bind size: 42KD)

product-image-AAA46522_WB15.jpg WB (Western Blot) (Anti- SP5 Picoband antibody, AAA46522, Western blottingAll lanes: Anti SP5 (AAA46522) at 0.5ug/mlWB: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 42KDObserved bind size: 42KD)
Related Product Information for anti-SP5 antibody
Description: Rabbit IgG polyclonal antibody for Transcription factor Sp5(SP5) detection. Tested with WB, IHC-P in Human.

Background: Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.
References
1. Chen Y; Guo Y; Ge X; Itoh H; Watanabe A; Fujiwara T; Kodama T; Aburatani H: Elevated expression and potential roles of human Sp5, a member of Sp transcription factor family, in human cancers. Biochem Biophys Res Commun, 2006 Feb 17. 2. Simmons SO; Horowitz JM: Nkx3.1 binds and negatively regulates the transcriptional activity of Sp-family members in prostate-derived cells. Biochem J, 2006 Jan 1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,964 Da
NCBI Official Full Name
transcription factor Sp5
NCBI Official Synonym Full Names
Sp5 transcription factor
NCBI Official Symbol
SP5
NCBI Protein Information
transcription factor Sp5
UniProt Protein Name
Transcription factor Sp5
UniProt Gene Name
SP5
UniProt Entry Name
SP5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SP5 sp5 (Catalog #AAA46522) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Sp5 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Sp5 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SP5 sp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Sp5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.