Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201273_WB13.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.)

Rabbit SPAM1 Polyclonal Antibody | anti-SPAM1 antibody

SPAM1 Antibody - middle region

Gene Names
SPAM1; HYA1; PH20; HYAL1; HYAL3; HYAL5; PH-20; SPAG15; HEL-S-96n
Reactivity
Human (Predicted Species Reactivity: Human)
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPAM1, Antibody; SPAM1 Antibody - middle region; anti-SPAM1 antibody
Ordering
Host
Rabbit
Reactivity
Human (Predicted Species Reactivity: Human)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP
Sequence Length
509
Applicable Applications for anti-SPAM1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human SPAM1
Protein Size (# AA)
509 amino acids
Enhanced Validation
WB
Y
SPR
YCHAROS
Blocking Peptide
For anti-SPAM1 (MBS3216352) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.)

product-image-AAA201273_WB13.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.)

WB (Western Blot)

(Host: RabbitTarget Name: SPAM1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201273_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SPAM1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SPAM1 antibody
Target Description: Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SPAM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
hyaluronidase PH-20 isoform 2
NCBI Official Synonym Full Names
sperm adhesion molecule 1
NCBI Official Symbol
SPAM1
NCBI Official Synonym Symbols
HYA1; PH20; HYAL1; HYAL3; HYAL5; PH-20; SPAG15; HEL-S-96n
NCBI Protein Information
hyaluronidase PH-20
UniProt Protein Name
Hyaluronidase PH-20
UniProt Gene Name
SPAM1
UniProt Synonym Gene Names
HYAL3; PH20; Hyal-PH20
UniProt Entry Name
HYALP_HUMAN

Similar Products

Product Notes

The SPAM1 spam1 (Catalog #AAA201273) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPAM1 Antibody - middle region reacts with Human (Predicted Species Reactivity: Human) and may cross-react with other species as described in the data sheet. AAA Biotech's SPAM1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SPAM1 spam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QQQNVQLSLT EATEKAKQEF EKAGKDFLVE TIKLGKLLRP NHLWGYYLFP. It is sometimes possible for the material contained within the vial of "SPAM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.