Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200084_WB10.jpg WB (Western Blot) (WB Suggested Anti-SPOP Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateSPOP is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit SPOP Polyclonal Antibody | anti-SPOP antibody

SPOP antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
SPOP; TEF2; BTBD32
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPOP, Antibody; SPOP antibody - C-terminal region; anti-SPOP antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Sequence Length
374
Applicable Applications for anti-SPOP antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SPOP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SPOP Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateSPOP is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA200084_WB10.jpg WB (Western Blot) (WB Suggested Anti-SPOP Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateSPOP is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: SPOPSample Type: HelaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

product-image-AAA200084_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SPOPSample Type: HelaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

WB (Western Blot)

(Host: RabbitTarget Name: SPOPSample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

product-image-AAA200084_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SPOPSample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SPOPSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200084_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SPOPSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-SPOP antibody
This is a rabbit polyclonal antibody against SPOP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SPOP may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein.
Product Categories/Family for anti-SPOP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
speckle-type POZ protein
NCBI Official Synonym Full Names
speckle type BTB/POZ protein
NCBI Official Symbol
SPOP
NCBI Official Synonym Symbols
TEF2; BTBD32
NCBI Protein Information
speckle-type POZ protein
UniProt Protein Name
Speckle-type POZ protein
UniProt Gene Name
SPOP
UniProt Entry Name
SPOP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SPOP spop (Catalog #AAA200084) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPOP antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SPOP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SPOP spop for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YHASDVLETS GWKSMVVSHP HLVAEAYRSL ASAQCPFLGP PRKRLKQS. It is sometimes possible for the material contained within the vial of "SPOP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.